BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021112 (865 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 23 2.3 U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic pr... 23 3.1 EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 23 4.1 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 22 5.4 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 7.1 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 7.1 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 7.1 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 7.1 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 23.4 bits (48), Expect = 2.3 Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = -3 Query: 179 QPKAARRRLLQS*S-LTPYLKLKCLSLK 99 +PK + LL S + L+PYL+ CLS + Sbjct: 250 RPKMTPQSLLPSQTGLSPYLRFGCLSTR 277 >U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic protein protein. Length = 372 Score = 23.0 bits (47), Expect = 3.1 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +3 Query: 243 CCLGIKPSVPDEMFH*NRPVSLPLF 317 CC G S+P ++ + + LPLF Sbjct: 13 CCWGKSLSIPQQILNEFKSTLLPLF 37 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 22.6 bits (46), Expect = 4.1 Identities = 11/42 (26%), Positives = 22/42 (52%) Frame = +1 Query: 358 NYSKRLAFNYLEEIAQEFFQQYGHRLNTVTRPYTFIEFDTCM 483 ++ + +++ +LE +A E + NTVT +T DT + Sbjct: 106 DFLREISWIFLETVANENTTNCPEQKNTVTVTFTVQSDDTTL 147 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 22.2 bits (45), Expect = 5.4 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = -2 Query: 228 WYSSILHALCSSSCIVAAKGSP 163 W +SI H+L + C V +P Sbjct: 184 WQNSIRHSLSFNDCFVKVPRTP 205 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.8 bits (44), Expect = 7.1 Identities = 5/16 (31%), Positives = 11/16 (68%) Frame = +3 Query: 171 LWLPLCKRMSRARAIY 218 +W P C+R++R ++ Sbjct: 481 IWTPKCERLARTEKLF 496 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.8 bits (44), Expect = 7.1 Identities = 5/16 (31%), Positives = 11/16 (68%) Frame = +3 Query: 171 LWLPLCKRMSRARAIY 218 +W P C+R++R ++ Sbjct: 481 IWTPKCERLARTEKLF 496 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.8 bits (44), Expect = 7.1 Identities = 5/16 (31%), Positives = 11/16 (68%) Frame = +3 Query: 171 LWLPLCKRMSRARAIY 218 +W P C+R++R ++ Sbjct: 481 IWTPKCERLARTEKLF 496 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.8 bits (44), Expect = 7.1 Identities = 5/16 (31%), Positives = 11/16 (68%) Frame = +3 Query: 171 LWLPLCKRMSRARAIY 218 +W P C+R++R ++ Sbjct: 481 IWTPKCERLARTEKLF 496 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,165 Number of Sequences: 336 Number of extensions: 3332 Number of successful extensions: 9 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 23789590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -