BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021112 (865 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor... 26 1.7 AY341224-1|AAR13788.1| 287|Anopheles gambiae TOLL9 protein. 24 5.2 AY341223-1|AAR13787.1| 287|Anopheles gambiae TOLL9 protein. 24 5.2 AY341222-1|AAR13786.1| 287|Anopheles gambiae TOLL9 protein. 24 5.2 AY341221-1|AAR13785.1| 287|Anopheles gambiae TOLL9 protein. 24 5.2 AY341220-1|AAR13784.1| 287|Anopheles gambiae TOLL9 protein. 24 5.2 AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. 24 5.2 U50479-1|AAA93478.1| 151|Anopheles gambiae protein ( Anopheles ... 24 6.9 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 24 6.9 DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 23 9.1 AY705401-1|AAU12510.1| 490|Anopheles gambiae nicotinic acetylch... 23 9.1 AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylch... 23 9.1 AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR ... 23 9.1 >DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor 22 protein. Length = 467 Score = 25.8 bits (54), Expect = 1.7 Identities = 10/39 (25%), Positives = 21/39 (53%) Frame = -3 Query: 815 ISPRQTVTIMESSREPRRKHNHEHDNCSGCHLHQHRLRV 699 ++P Q + + R + H E DN S H+++ +L++ Sbjct: 18 LNPNQRQQLEDRRRIKEQLHQLEQDNESPTHMYRRKLKI 56 >AY341224-1|AAR13788.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 24.2 bits (50), Expect = 5.2 Identities = 12/26 (46%), Positives = 13/26 (50%), Gaps = 2/26 (7%) Frame = +1 Query: 94 LCLSERHFNFKYGV--NDYDCKSRRR 165 LCL ER F YG+ N C R R Sbjct: 236 LCLHERDFEVGYGILENIISCMDRSR 261 >AY341223-1|AAR13787.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 24.2 bits (50), Expect = 5.2 Identities = 12/26 (46%), Positives = 13/26 (50%), Gaps = 2/26 (7%) Frame = +1 Query: 94 LCLSERHFNFKYGV--NDYDCKSRRR 165 LCL ER F YG+ N C R R Sbjct: 236 LCLHERDFEVGYGILENIISCMDRSR 261 >AY341222-1|AAR13786.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 24.2 bits (50), Expect = 5.2 Identities = 12/26 (46%), Positives = 13/26 (50%), Gaps = 2/26 (7%) Frame = +1 Query: 94 LCLSERHFNFKYGV--NDYDCKSRRR 165 LCL ER F YG+ N C R R Sbjct: 236 LCLHERDFEVGYGILENIISCMDRSR 261 >AY341221-1|AAR13785.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 24.2 bits (50), Expect = 5.2 Identities = 12/26 (46%), Positives = 13/26 (50%), Gaps = 2/26 (7%) Frame = +1 Query: 94 LCLSERHFNFKYGV--NDYDCKSRRR 165 LCL ER F YG+ N C R R Sbjct: 236 LCLHERDFEVGYGILENIISCMDRSR 261 >AY341220-1|AAR13784.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 24.2 bits (50), Expect = 5.2 Identities = 12/26 (46%), Positives = 13/26 (50%), Gaps = 2/26 (7%) Frame = +1 Query: 94 LCLSERHFNFKYGV--NDYDCKSRRR 165 LCL ER F YG+ N C R R Sbjct: 236 LCLHERDFEVGYGILENIISCMDRSR 261 >AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. Length = 576 Score = 24.2 bits (50), Expect = 5.2 Identities = 12/26 (46%), Positives = 13/26 (50%), Gaps = 2/26 (7%) Frame = +1 Query: 94 LCLSERHFNFKYGV--NDYDCKSRRR 165 LCL ER F YG+ N C R R Sbjct: 463 LCLHERDFEVGYGILENIISCMDRSR 488 >U50479-1|AAA93478.1| 151|Anopheles gambiae protein ( Anopheles gambiae putativeribosomal protein S13 mRNA, complete cds. ). Length = 151 Score = 23.8 bits (49), Expect = 6.9 Identities = 6/30 (20%), Positives = 20/30 (66%) Frame = +3 Query: 195 MSRARAIYSSTRIRLKCCLGIKPSVPDEMF 284 +++ R + + +R+ +G+KP +P++++ Sbjct: 60 VAQVRFVNGNKVLRIMKAVGLKPDIPEDLY 89 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 23.8 bits (49), Expect = 6.9 Identities = 14/47 (29%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = +3 Query: 594 IDDVLQRGAILSE-LDTKTQNLSMMSQKYRKDATYLNTKSMLVKVTA 731 + D+ + +IL E L+ NLS++ + +K YL ++L ++TA Sbjct: 1065 LPDLQYQISILEEKLNANKPNLSVIDEFLKKREAYLMRVAVLEEITA 1111 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 23.4 bits (48), Expect = 9.1 Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = -3 Query: 179 QPKAARRRLLQS*S-LTPYLKLKCLSLK 99 +PK + LL S + L+PYL+ CLS + Sbjct: 237 RPKMTPQSLLASQTGLSPYLRFGCLSTR 264 >AY705401-1|AAU12510.1| 490|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 6 protein. Length = 490 Score = 23.4 bits (48), Expect = 9.1 Identities = 6/18 (33%), Positives = 14/18 (77%) Frame = -1 Query: 691 VASFRYFCDIIDRFCVFV 638 ++ +++ ++DRFC+FV Sbjct: 451 ISDWKFAAMVVDRFCLFV 468 >AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 6 protein. Length = 490 Score = 23.4 bits (48), Expect = 9.1 Identities = 6/18 (33%), Positives = 14/18 (77%) Frame = -1 Query: 691 VASFRYFCDIIDRFCVFV 638 ++ +++ ++DRFC+FV Sbjct: 451 ISDWKFAAMVVDRFCLFV 468 >AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR protein. Length = 640 Score = 23.4 bits (48), Expect = 9.1 Identities = 10/29 (34%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = +1 Query: 301 YLFHYLIENHICY--LVLCERNYSKRLAF 381 + FH+L +H CY ++ C N R F Sbjct: 550 FAFHWLAMSHSCYNPIIYCYMNARFRSGF 578 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 751,950 Number of Sequences: 2352 Number of extensions: 13830 Number of successful extensions: 37 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 92199573 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -