BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021112 (865 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 23 2.7 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 22 8.4 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 23.4 bits (48), Expect = 2.7 Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = -3 Query: 179 QPKAARRRLLQS*S-LTPYLKLKCLSLK 99 +PK + LL S + L+PYL+ CLS + Sbjct: 254 RPKMTPQSLLPSQTGLSPYLRFGCLSTR 281 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 21.8 bits (44), Expect = 8.4 Identities = 11/47 (23%), Positives = 22/47 (46%) Frame = -1 Query: 778 LENPEESTITSTITAPAVTFTSIDFVLRYVASFRYFCDIIDRFCVFV 638 L +PE S T + A + D ++ ++Y +IDR +++ Sbjct: 439 LLSPEASKATEAVEFIAEHLRNEDLYIQTREDWKYVAMVIDRLQLYI 485 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 201,616 Number of Sequences: 438 Number of extensions: 3864 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27916710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -