BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021109 (828 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 31 0.057 AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 26 1.6 AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein pr... 24 6.6 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 30.7 bits (66), Expect = 0.057 Identities = 21/69 (30%), Positives = 36/69 (52%), Gaps = 1/69 (1%) Frame = +2 Query: 41 KSEKPASSEDKDTPIRQIMTIIEHKIRNLEKRKSKLTSYRDLQKAGKELNSDQKVAVAK- 217 + E+ A+ +D+ +R + EH+IRN E +K S D +A E + VA+ + Sbjct: 324 QEEQLAAVDDELKKLRTSIEEQEHRIRNREALVAKTDSTIDTYRADIESKKQEYVALKEA 383 Query: 218 YDEVAQTLE 244 Y V +TL+ Sbjct: 384 YGTVRRTLQ 392 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 25.8 bits (54), Expect = 1.6 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = +1 Query: 457 TEDDLKILDDLYPEVT 504 T+ +LKILDD+ PE+T Sbjct: 1029 TKRELKILDDIMPEMT 1044 >AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein protein. Length = 476 Score = 23.8 bits (49), Expect = 6.6 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 6/36 (16%) Frame = +2 Query: 155 YRDLQKAGKELNSDQKVAVA------KYDEVAQTLE 244 + L AG+EL+S KVA+ YD + TLE Sbjct: 125 FSSLMNAGQELDSSLKVAMVLKSMPESYDHLTTTLE 160 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 770,911 Number of Sequences: 2352 Number of extensions: 12427 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 88150236 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -