BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021108 (851 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 23 3.6 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 23 3.6 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 23 3.6 DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein ... 23 4.7 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 23 4.7 AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. 23 4.7 AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein ... 23 4.7 DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 22 8.2 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 22 8.2 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 22 8.2 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 22 8.2 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 22 8.2 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 23.0 bits (47), Expect = 3.6 Identities = 7/23 (30%), Positives = 15/23 (65%) Frame = +2 Query: 566 EMENFGGQDQIQKHRLLANMYLL 634 ++ ++ G++ + H+LL N Y L Sbjct: 250 DLPDYRGEEYLYSHKLLLNRYYL 272 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 23.0 bits (47), Expect = 3.6 Identities = 7/23 (30%), Positives = 15/23 (65%) Frame = +2 Query: 566 EMENFGGQDQIQKHRLLANMYLL 634 ++ ++ G++ + H+LL N Y L Sbjct: 250 DLPDYRGEEYLYSHKLLLNRYYL 272 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 23.0 bits (47), Expect = 3.6 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -1 Query: 821 SSNYKESTWINVNYSSLIKICAGITSLMTF 732 SSN V YS L ++C I+S M + Sbjct: 87 SSNASVEPDSKVTYSGLWRVCVAISSRMEY 116 >DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein 1 protein. Length = 116 Score = 22.6 bits (46), Expect = 4.7 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = +3 Query: 519 CSACTQTQSENCRAQAKW 572 C CT+ Q +N A+W Sbjct: 75 CKKCTEIQKQNLDKLAEW 92 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 22.6 bits (46), Expect = 4.7 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +3 Query: 627 ICWWCNSPTESSYCSRVTATL*KDYPRDL 713 IC+ C T +S R+ L DY RD+ Sbjct: 24 ICFVCKDITSTSALYRLKLYLFCDYDRDI 52 >AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. Length = 349 Score = 22.6 bits (46), Expect = 4.7 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 114 ILIHLPYHNCVRWFSRIHSFLKSPAF 37 I+ HL H V W+S+ +F P + Sbjct: 173 IVFHLETHPNVTWYSQCVTFNAFPTY 198 >AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein protein. Length = 116 Score = 22.6 bits (46), Expect = 4.7 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = +3 Query: 519 CSACTQTQSENCRAQAKW 572 C CT+ Q +N A+W Sbjct: 75 CKKCTEIQKQNLDKLAEW 92 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 8.2 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -1 Query: 821 SSNYKESTWINVNYSSLIKI 762 ++NYK+ + N+NY I I Sbjct: 104 NNNYKKLQYYNINYIEQIPI 123 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 8.2 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -1 Query: 821 SSNYKESTWINVNYSSLIKI 762 ++NYK+ + N+NY I I Sbjct: 104 NNNYKKLQYYNINYIEQIPI 123 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 8.2 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -1 Query: 821 SSNYKESTWINVNYSSLIKI 762 ++NYK+ + N+NY I I Sbjct: 104 NNNYKKLQYYNINYIEQIPI 123 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 8.2 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -1 Query: 821 SSNYKESTWINVNYSSLIKI 762 ++NYK+ + N+NY I I Sbjct: 104 NNNYKKLQYYNINYIEQIPI 123 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 21.8 bits (44), Expect = 8.2 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = -3 Query: 480 PNIKPWSPAPTSSSFLFSCTPAAMFGDCWSSASITLH 370 PN++P S +++ P M D W+S + LH Sbjct: 57 PNVRPISSHQIANNVTMQLLPKLMEFDDWTSV-MELH 92 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 253,145 Number of Sequences: 438 Number of extensions: 5546 Number of successful extensions: 35 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27431202 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -