BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021105X (464 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alp... 33 0.002 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 33 0.002 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 29 0.019 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 25 0.30 EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-a... 23 1.2 AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-a... 23 1.2 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 23 2.1 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 22 2.8 D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 22 3.7 AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. 22 3.7 AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta... 22 3.7 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 22 3.7 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 21 4.9 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 21 4.9 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 21 6.5 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 21 6.5 >X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alpha protein. Length = 461 Score = 32.7 bits (71), Expect = 0.002 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = +2 Query: 113 MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 208 M K++ N+ VI HVD GKST T L+ K G Sbjct: 1 MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCG 32 Score = 23.4 bits (48), Expect = 1.2 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +3 Query: 378 FLINLIDSPGHVDF 419 + + +ID+PGH DF Sbjct: 85 YYVTIIDAPGHRDF 98 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 32.7 bits (71), Expect = 0.002 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = +2 Query: 113 MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 208 M K++ N+ VI HVD GKST T L+ K G Sbjct: 1 MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCG 32 Score = 23.4 bits (48), Expect = 1.2 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +3 Query: 378 FLINLIDSPGHVDF 419 + + +ID+PGH DF Sbjct: 85 YYVTIIDAPGHRDF 98 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 29.5 bits (63), Expect = 0.019 Identities = 10/18 (55%), Positives = 16/18 (88%) Frame = +2 Query: 140 MSVIAHVDHGKSTLTDSL 193 ++++ HVDHGK+TL D+L Sbjct: 148 VTIMGHVDHGKTTLLDAL 165 Score = 22.2 bits (45), Expect = 2.8 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = +3 Query: 369 EKGFLINLIDSPGHVDFSS 425 E G + +D+PGH F S Sbjct: 190 ESGERVTFLDTPGHAAFIS 208 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 25.4 bits (53), Expect = 0.30 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +2 Query: 137 NMSVIAHVDHGKSTLTDSL 193 N+ I HV HGKST+ ++ Sbjct: 44 NIGTIGHVAHGKSTIVKAI 62 >EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-alpha protein. Length = 172 Score = 23.4 bits (48), Expect = 1.2 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +3 Query: 378 FLINLIDSPGHVDF 419 + + +ID+PGH DF Sbjct: 12 YYVTIIDAPGHRDF 25 >AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-alpha protein. Length = 274 Score = 23.4 bits (48), Expect = 1.2 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +3 Query: 378 FLINLIDSPGHVDF 419 + + +ID+PGH DF Sbjct: 28 YYVTIIDAPGHRDF 41 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 22.6 bits (46), Expect = 2.1 Identities = 8/21 (38%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = +3 Query: 3 PFSKRTPLLAYGSW-FNRTKI 62 PF ++T ++ +GSW FN ++ Sbjct: 159 PFDQQTCIMKFGSWTFNGDQV 179 Score = 22.2 bits (45), Expect = 2.8 Identities = 6/14 (42%), Positives = 10/14 (71%) Frame = -2 Query: 118 VHHPTDLVYREIHH 77 +HHP + R++HH Sbjct: 400 LHHPNCKINRKVHH 413 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 22.2 bits (45), Expect = 2.8 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +3 Query: 3 PFSKRTPLLAYGSW 44 PF ++T +L +GSW Sbjct: 161 PFDEQTCVLKFGSW 174 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.8 bits (44), Expect = 3.7 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +3 Query: 297 ISMFFELEEKDLVFITNPDQREKSEKGFLI 386 ++MF+ D+ I+N +Q + S GF I Sbjct: 527 LNMFYNNFNSDIKSISNNEQVKVSALGFFI 556 >AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. Length = 145 Score = 21.8 bits (44), Expect = 3.7 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 276 CNGLVRPSRVSETGLS 229 CN V+PS S TG S Sbjct: 73 CNSQVQPSVASTTGFS 88 >AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta protein precursor protein. Length = 145 Score = 21.8 bits (44), Expect = 3.7 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 276 CNGLVRPSRVSETGLS 229 CN V+PS S TG S Sbjct: 73 CNSQVQPSVASTTGFS 88 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.8 bits (44), Expect = 3.7 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +3 Query: 297 ISMFFELEEKDLVFITNPDQREKSEKGFLI 386 ++MF+ D+ I+N +Q + S GF I Sbjct: 527 LNMFYNNFNSDIKSISNNEQVKVSALGFFI 556 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 21.4 bits (43), Expect = 4.9 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = +3 Query: 3 PFSKRTPLLAYGSW 44 PF ++T ++ +GSW Sbjct: 157 PFDEQTCVMKFGSW 170 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 21.4 bits (43), Expect = 4.9 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = +3 Query: 273 CITIKSTAISMFF 311 C T+K +A+ M+F Sbjct: 688 CATVKGSAVDMYF 700 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 21.0 bits (42), Expect = 6.5 Identities = 6/14 (42%), Positives = 10/14 (71%) Frame = +3 Query: 3 PFSKRTPLLAYGSW 44 PF ++T + +GSW Sbjct: 153 PFDEQTCFMKFGSW 166 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 21.0 bits (42), Expect = 6.5 Identities = 6/14 (42%), Positives = 10/14 (71%) Frame = +3 Query: 3 PFSKRTPLLAYGSW 44 PF ++T + +GSW Sbjct: 153 PFDQQTCFMKFGSW 166 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 127,029 Number of Sequences: 438 Number of extensions: 2739 Number of successful extensions: 20 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12436029 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -