BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021104 (715 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43456| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_31467| Best HMM Match : CTP_transf_2 (HMM E-Value=0.85) 29 4.9 >SB_43456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 359 Score = 28.7 bits (61), Expect = 4.9 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +3 Query: 351 LITNLMLNTKGISDVCFKGKKKHLLSGAL 437 L+T+ + K I+ +CF G K LLSG++ Sbjct: 224 LVTSFSNHQKTITSLCFDGAYKRLLSGSI 252 >SB_31467| Best HMM Match : CTP_transf_2 (HMM E-Value=0.85) Length = 1459 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/52 (30%), Positives = 25/52 (48%) Frame = +3 Query: 372 NTKGISDVCFKGKKKHLLSGALL*NFLDKLMLVFFFLSKSCSGTLFFFWYIE 527 N GI+ V FKG + L +L N++ + L + G LFF W ++ Sbjct: 96 NDSGIASVTFKGVIEDFLVFLILYNYVIPISLYVTVELQKFIGALFFAWDVK 147 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,917,126 Number of Sequences: 59808 Number of extensions: 376867 Number of successful extensions: 617 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 576 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 612 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1889780269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -