BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021055 (672 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC16A3.12c |||triglyceride lipase-cholesterol esterase |Schizo... 27 1.9 SPAC11D3.08c |||amino acid permease, unknown 1|Schizosaccharomyc... 25 9.9 >SPBC16A3.12c |||triglyceride lipase-cholesterol esterase |Schizosaccharomyces pombe|chr 2|||Manual Length = 443 Score = 27.5 bits (58), Expect = 1.9 Identities = 12/40 (30%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +1 Query: 286 SKTEQGLNGCITKSRIFYSLITEAGYKIYP-LIKTQVRYV 402 SKT G+ + K R Y + GY++ L++TQ ++ Sbjct: 59 SKTTDGMTDAVQKCRNIYEICEAFGYRVEEHLVRTQDNFI 98 >SPAC11D3.08c |||amino acid permease, unknown 1|Schizosaccharomyces pombe|chr 1|||Manual Length = 550 Score = 25.0 bits (52), Expect = 9.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -2 Query: 542 IATIAKPESRAVFCW 498 I T+A P SRA CW Sbjct: 117 IFTLASPSSRAFLCW 131 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,855,022 Number of Sequences: 5004 Number of extensions: 60193 Number of successful extensions: 114 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 114 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 114 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 307866294 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -