BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021055 (672 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U22832-1|AAA64507.1| 293|Caenorhabditis elegans Hypothetical pr... 34 0.080 Z81527-11|CAI91173.1| 390|Caenorhabditis elegans Hypothetical p... 28 6.9 >U22832-1|AAA64507.1| 293|Caenorhabditis elegans Hypothetical protein C09F5.2 protein. Length = 293 Score = 34.3 bits (75), Expect = 0.080 Identities = 16/33 (48%), Positives = 21/33 (63%) Frame = +3 Query: 573 AVPKEMLVAFTVCTTLLVESTCSRLMISTCILP 671 + PK +L+ V T+LLV LM+STCILP Sbjct: 142 STPKPLLIVLGVVTSLLVSVHLLALMMSTCILP 174 >Z81527-11|CAI91173.1| 390|Caenorhabditis elegans Hypothetical protein F35E12.9b protein. Length = 390 Score = 27.9 bits (59), Expect = 6.9 Identities = 12/42 (28%), Positives = 24/42 (57%) Frame = -1 Query: 300 LLSFGHQLLEGYRPPVKRSGSCFHQYWLTKPTYLNKLHDNPS 175 +L++ ++ LE Y+ +K++G F +T +Y DNP+ Sbjct: 73 MLTYLYKSLEAYKQTIKKTGEYFPLSLVTGISYYTITSDNPN 114 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,873,661 Number of Sequences: 27780 Number of extensions: 339008 Number of successful extensions: 684 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 666 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 684 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1518563232 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -