BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021055 (672 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 24 1.5 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 24 1.5 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 23 3.5 DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 22 4.6 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 21 8.1 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 23.8 bits (49), Expect = 1.5 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 435 FIRRRTSRGGSCSLVGRN*RLPAKHCPTFRFRYG 536 ++ R ++ G S V + +P + PT RFR G Sbjct: 270 YLERLSNDMGEVSYVSLDHPIPTGYYPTMRFRNG 303 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 23.8 bits (49), Expect = 1.5 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 435 FIRRRTSRGGSCSLVGRN*RLPAKHCPTFRFRYG 536 ++ R ++ G S V + +P + PT RFR G Sbjct: 270 YLERLSNDMGEVSYVSLDHPIPTGYYPTMRFRNG 303 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 22.6 bits (46), Expect = 3.5 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -2 Query: 422 TVSASHPT*RTCVFIRG 372 T +HP R CVF+ G Sbjct: 167 TAHVTHPRHRLCVFVAG 183 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 22.2 bits (45), Expect = 4.6 Identities = 7/20 (35%), Positives = 13/20 (65%) Frame = -2 Query: 197 TSCTTILPSEASRSLAGYYI 138 T+CT I+ + A ++ YY+ Sbjct: 60 TTCTVIIKNPAMQTATNYYL 79 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 21.4 bits (43), Expect = 8.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +2 Query: 386 HKCVMSGETPIQSG 427 HKC + +T IQSG Sbjct: 176 HKCTVCSKTFIQSG 189 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,060 Number of Sequences: 438 Number of extensions: 4496 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20343105 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -