BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021055 (672 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g03890.2 68416.m00403 expressed protein 28 4.9 At3g03890.1 68416.m00402 expressed protein 28 4.9 At5g48090.1 68418.m05941 expressed protein ; expression supporte... 27 8.6 >At3g03890.2 68416.m00403 expressed protein Length = 305 Score = 28.3 bits (60), Expect = 4.9 Identities = 13/31 (41%), Positives = 22/31 (70%) Frame = -3 Query: 649 MSREHVDSTKSVVHTVKATSISFGTAVGLDL 557 M+++H + TK++VH + TSI +A+ LDL Sbjct: 247 MNKDHEEDTKAIVHNI--TSIPVESALMLDL 275 >At3g03890.1 68416.m00402 expressed protein Length = 321 Score = 28.3 bits (60), Expect = 4.9 Identities = 13/31 (41%), Positives = 22/31 (70%) Frame = -3 Query: 649 MSREHVDSTKSVVHTVKATSISFGTAVGLDL 557 M+++H + TK++VH + TSI +A+ LDL Sbjct: 247 MNKDHEEDTKAIVHNI--TSIPVESALMLDL 275 >At5g48090.1 68418.m05941 expressed protein ; expression supported by MPSS Length = 636 Score = 27.5 bits (58), Expect = 8.6 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = -1 Query: 390 LCFYKRIDLISCFSDQRIEYSGFRYAAIQSLLSFGHQLLEGYRPP 256 +CFYK +DLI ++ E + + + L G QL+ G PP Sbjct: 458 ICFYKNLDLIPPKNNFNFEMRDW-LSVKEEELPDGSQLIMGLNPP 501 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,059,326 Number of Sequences: 28952 Number of extensions: 323090 Number of successful extensions: 694 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 677 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 694 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1422784080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -