BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021054 (711 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g31300.1 68415.m03821 transducin family protein / WD-40 repea... 101 4e-22 At2g30910.2 68415.m03768 transducin family protein / WD-40 repea... 101 4e-22 At2g30910.1 68415.m03767 transducin family protein / WD-40 repea... 101 4e-22 At2g26060.1 68415.m03129 transducin family protein / WD-40 repea... 42 4e-04 At3g01340.1 68416.m00051 protein transport protein SEC13 family ... 41 7e-04 At2g30050.1 68415.m03654 transducin family protein / WD-40 repea... 40 0.001 At2g01330.1 68415.m00050 transducin family protein / WD-40 repea... 37 0.011 At4g34460.2 68417.m04898 guanine nucleotide-binding protein beta... 36 0.027 At4g32990.1 68417.m04692 transducin family protein / WD-40 repea... 35 0.061 At4g34460.3 68417.m04900 guanine nucleotide-binding protein beta... 33 0.14 At4g34460.1 68417.m04899 guanine nucleotide-binding protein beta... 33 0.14 At3g18060.1 68416.m02297 transducin family protein / WD-40 repea... 33 0.14 At5g43920.1 68418.m05372 transducin family protein / WD-40 repea... 33 0.25 At1g49540.1 68414.m05553 transducin family protein / WD-40 repea... 33 0.25 At3g44530.1 68416.m04786 transducin family protein / WD-40 repea... 32 0.33 At5g64630.3 68418.m08123 transducin family protein / WD-40 repea... 32 0.43 At5g64630.2 68418.m08122 transducin family protein / WD-40 repea... 32 0.43 At5g64630.1 68418.m08121 transducin family protein / WD-40 repea... 32 0.43 At5g13840.1 68418.m01618 WD-40 repeat family protein contains 6 ... 32 0.43 At4g29730.1 68417.m04233 WD-40 repeat family protein contains 5 ... 31 0.57 At5g13480.1 68418.m01554 WD-40 repeat family protein similar to ... 31 0.75 At4g33270.1 68417.m04734 WD-40 repeat family protein contains 6 ... 31 0.75 At4g33260.1 68417.m04733 WD-40 repeat family protein contains 6 ... 31 0.75 At2g41500.1 68415.m05127 WD-40 repeat family protein / small nuc... 31 0.75 At4g32551.1 68417.m04633 WD-40 repeat family protein (LEUNIG) co... 30 1.3 At1g04510.1 68414.m00442 transducin family protein / WD-40 repea... 30 1.7 At5g24320.2 68418.m02866 WD-40 repeat family protein contains Pf... 29 2.3 At5g24320.1 68418.m02865 WD-40 repeat family protein contains Pf... 29 2.3 At4g11920.1 68417.m01895 WD-40 repeat family protein contains 6 ... 29 2.3 At2g33340.2 68415.m04087 transducin family protein / WD-40 repea... 29 2.3 At2g33340.1 68415.m04086 transducin family protein / WD-40 repea... 29 2.3 At2g32700.5 68415.m04001 WD-40 repeat family protein contains 7 ... 29 2.3 At2g32700.4 68415.m04000 WD-40 repeat family protein contains 7 ... 29 2.3 At2g32700.3 68415.m03999 WD-40 repeat family protein contains 7 ... 29 2.3 At2g32700.2 68415.m03998 WD-40 repeat family protein contains 7 ... 29 2.3 At2g32700.1 68415.m03997 WD-40 repeat family protein contains 7 ... 29 2.3 At5g67320.1 68418.m08490 WD-40 repeat family protein strong simi... 29 3.0 At5g25150.1 68418.m02981 transducin family protein / WD-40 repea... 29 3.0 At5g08560.1 68418.m01018 transducin family protein / WD-40 repea... 29 3.0 At4g00090.1 68417.m00009 transducin family protein / WD-40 repea... 29 3.0 At5g26900.1 68418.m03208 WD-40 repeat family protein contains 5 ... 29 4.0 At5g23430.2 68418.m02749 transducin family protein / WD-40 repea... 29 4.0 At5g23430.1 68418.m02748 transducin family protein / WD-40 repea... 29 4.0 At5g08390.1 68418.m00988 transducin family protein / WD-40 repea... 29 4.0 At4g29860.1 68417.m04250 transducin family protein / WD-40 repea... 29 4.0 At2g19520.1 68415.m02281 WD-40 repeat protein (MSI4) contains 6 ... 28 5.3 At4g26400.2 68417.m03800 zinc finger (C3HC4-type RING finger) fa... 28 7.0 At4g26400.1 68417.m03799 zinc finger (C3HC4-type RING finger) fa... 28 7.0 At5g56130.1 68418.m07002 transducin family protein / WD-40 repea... 27 9.3 At5g32070.1 68418.m03689 hypothetical protein 27 9.3 At5g27945.1 68418.m03364 transducin family protein / WD-40 repea... 27 9.3 At3g27640.1 68416.m03452 transducin family protein / WD-40 repea... 27 9.3 At3g21540.1 68416.m02717 transducin family protein / WD-40 repea... 27 9.3 At3g15980.3 68416.m02022 coatomer protein complex, subunit beta ... 27 9.3 At3g15980.2 68416.m02021 coatomer protein complex, subunit beta ... 27 9.3 At3g15980.1 68416.m02020 coatomer protein complex, subunit beta ... 27 9.3 At2g37670.1 68415.m04620 WD-40 repeat family protein contains 6 ... 27 9.3 >At2g31300.1 68415.m03821 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); identical to putative ARP2/3 protein complex subunit p41 (GI:4432825)[Arabidopsis thaliana]; similar to ARP2/3 complex 41 kDa subunit (P41-ARC) (Actin-related protein 2/3 complex subunit 1B) (SP:Q9WV32) [Mus musculus] Length = 378 Score = 101 bits (243), Expect = 4e-22 Identities = 47/93 (50%), Positives = 61/93 (65%), Gaps = 1/93 (1%) Frame = +3 Query: 255 AFSPNNNEVHIYKKEGND-WKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQG 431 A PNN EVHIYK D W++ + L +HD V GIDW+ +N+IVT S DRN+YVW+ Sbjct: 26 ALCPNNTEVHIYKSLSQDHWERLHVLQKHDQIVSGIDWSSKSNKIVTVSHDRNSYVWSL- 84 Query: 432 DDGKWATTLVLLRINRAATCVKWSPMRTSLLSG 530 + +W TLV+LR+NRAA CV+WSP G Sbjct: 85 EGAEWVPTLVILRLNRAALCVQWSPKENKFAVG 117 Score = 61.3 bits (142), Expect = 6e-10 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +2 Query: 509 ENKFAVGSGARLISICYFEKENNWWVSKHIKK 604 ENKFAVGSGA+ + ICY+E+ENNWWVSK I+K Sbjct: 111 ENKFAVGSGAKTVCICYYEQENNWWVSKLIRK 142 Score = 43.6 bits (98), Expect = 1e-04 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +1 Query: 613 STVTSIDWHPNNILLVAGSADFKVRVFSA*YQG 711 S+VTS+ WHPNN+LL S D K RVFS +G Sbjct: 146 SSVTSVAWHPNNVLLATTSTDGKCRVFSTFIKG 178 Score = 29.5 bits (63), Expect = 2.3 Identities = 17/70 (24%), Positives = 29/70 (41%), Gaps = 4/70 (5%) Frame = +3 Query: 228 CMEQG*KSNAFSPNNNEVHI----YKKEGNDWKQTNNLVEHDLRVMGIDWAPNTNRIVTC 395 C++ K N F+ + + Y++E N W H+ V + W PN + T Sbjct: 104 CVQWSPKENKFAVGSGAKTVCICYYEQENNWWVSKLIRKRHESSVTSVAWHPNNVLLATT 163 Query: 396 SVDRNAYVWT 425 S D V++ Sbjct: 164 STDGKCRVFS 173 >At2g30910.2 68415.m03768 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400) (1 weak); similar to ARP2/3 complex 41 kDa subunit (P41-ARC) (Actin-related protein 2/3 complex subunit 1B) (SP:O88656) [Rattus norvegicus] Length = 378 Score = 101 bits (243), Expect = 4e-22 Identities = 47/93 (50%), Positives = 61/93 (65%), Gaps = 1/93 (1%) Frame = +3 Query: 255 AFSPNNNEVHIYKKEGND-WKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQG 431 A PNN EVHIYK D W++ + L +HD V GIDW+ +N+IVT S DRN+YVW+ Sbjct: 26 ALCPNNTEVHIYKSLSQDHWERLHVLQKHDQIVSGIDWSSKSNKIVTVSHDRNSYVWSL- 84 Query: 432 DDGKWATTLVLLRINRAATCVKWSPMRTSLLSG 530 + +W TLV+LR+NRAA CV+WSP G Sbjct: 85 EGAEWVPTLVILRLNRAALCVQWSPKENKFAVG 117 Score = 61.3 bits (142), Expect = 6e-10 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +2 Query: 509 ENKFAVGSGARLISICYFEKENNWWVSKHIKK 604 ENKFAVGSGA+ + ICY+E+ENNWWVSK I+K Sbjct: 111 ENKFAVGSGAKTVCICYYEQENNWWVSKLIRK 142 Score = 43.6 bits (98), Expect = 1e-04 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +1 Query: 613 STVTSIDWHPNNILLVAGSADFKVRVFSA*YQG 711 S+VTS+ WHPNN+LL S D K RVFS +G Sbjct: 146 SSVTSVAWHPNNVLLATTSTDGKCRVFSTFIKG 178 Score = 31.1 bits (67), Expect = 0.75 Identities = 21/81 (25%), Positives = 35/81 (43%), Gaps = 7/81 (8%) Frame = +3 Query: 228 CMEQG*KSNAFSPNNNEVHI----YKKEGNDWKQTNNLVEHDLRVMGIDWAPNTNRIVTC 395 C++ K N F+ + + Y++E N W H+ V + W PN + T Sbjct: 104 CVQWSPKENKFAVGSGAKTVCICYYEQENNWWVSKLIRKRHESSVTSVAWHPNNVLLATT 163 Query: 396 SVDRNAYVWT---QGDDGKWA 449 S D V++ +G D K+A Sbjct: 164 STDGKCRVFSTFIKGVDTKYA 184 >At2g30910.1 68415.m03767 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400) (1 weak); similar to ARP2/3 complex 41 kDa subunit (P41-ARC) (Actin-related protein 2/3 complex subunit 1B) (SP:O88656) [Rattus norvegicus] Length = 378 Score = 101 bits (243), Expect = 4e-22 Identities = 47/93 (50%), Positives = 61/93 (65%), Gaps = 1/93 (1%) Frame = +3 Query: 255 AFSPNNNEVHIYKKEGND-WKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQG 431 A PNN EVHIYK D W++ + L +HD V GIDW+ +N+IVT S DRN+YVW+ Sbjct: 26 ALCPNNTEVHIYKSLSQDHWERLHVLQKHDQIVSGIDWSSKSNKIVTVSHDRNSYVWSL- 84 Query: 432 DDGKWATTLVLLRINRAATCVKWSPMRTSLLSG 530 + +W TLV+LR+NRAA CV+WSP G Sbjct: 85 EGAEWVPTLVILRLNRAALCVQWSPKENKFAVG 117 Score = 61.3 bits (142), Expect = 6e-10 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +2 Query: 509 ENKFAVGSGARLISICYFEKENNWWVSKHIKK 604 ENKFAVGSGA+ + ICY+E+ENNWWVSK I+K Sbjct: 111 ENKFAVGSGAKTVCICYYEQENNWWVSKLIRK 142 Score = 43.6 bits (98), Expect = 1e-04 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +1 Query: 613 STVTSIDWHPNNILLVAGSADFKVRVFSA*YQG 711 S+VTS+ WHPNN+LL S D K RVFS +G Sbjct: 146 SSVTSVAWHPNNVLLATTSTDGKCRVFSTFIKG 178 Score = 29.5 bits (63), Expect = 2.3 Identities = 17/70 (24%), Positives = 29/70 (41%), Gaps = 4/70 (5%) Frame = +3 Query: 228 CMEQG*KSNAFSPNNNEVHI----YKKEGNDWKQTNNLVEHDLRVMGIDWAPNTNRIVTC 395 C++ K N F+ + + Y++E N W H+ V + W PN + T Sbjct: 104 CVQWSPKENKFAVGSGAKTVCICYYEQENNWWVSKLIRKRHESSVTSVAWHPNNVLLATT 163 Query: 396 SVDRNAYVWT 425 S D V++ Sbjct: 164 STDGKCRVFS 173 >At2g26060.1 68415.m03129 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to WD40-repeat containing protein Ciao 1 (SP:O76071) [Homo sapiens] Length = 352 Score = 41.9 bits (94), Expect = 4e-04 Identities = 19/81 (23%), Positives = 39/81 (48%) Frame = +3 Query: 285 IYKKEGNDWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVL 464 I+K G++++ + L H+ V + W + + + TCS D++ ++W + ++ VL Sbjct: 100 IWKNYGSEFECISTLEGHENEVKSVSWNASGSCLATCSRDKSVWIWEVLEGNEYDCAAVL 159 Query: 465 LRINRAATCVKWSPMRTSLLS 527 + V+W P L S Sbjct: 160 TGHTQDVKMVQWHPTMDVLFS 180 Score = 39.5 bits (88), Expect = 0.002 Identities = 20/70 (28%), Positives = 31/70 (44%), Gaps = 1/70 (1%) Frame = +3 Query: 297 EGNDWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYV-WTQGDDGKWATTLVLLRI 473 EGN++ L H V + W P + + +CS D V W++ DDG++ L Sbjct: 149 EGNEYDCAAVLTGHTQDVKMVQWHPTMDVLFSCSYDNTIKVWWSEDDDGEYQCVQTLGES 208 Query: 474 NRAATCVKWS 503 N + WS Sbjct: 209 NNGHSSTVWS 218 >At3g01340.1 68416.m00051 protein transport protein SEC13 family protein / WD-40 repeat family protein similar to Protein transport protein SEC13 SP|Q04491 {Saccharomyces cerevisiae} and SEC13 (SP:P53024) [Pichia pastoris] Length = 302 Score = 41.1 bits (92), Expect = 7e-04 Identities = 25/75 (33%), Positives = 35/75 (46%), Gaps = 4/75 (5%) Frame = +3 Query: 294 KEGND--WKQTNNLVEHDLRVMGIDWAPNTNRI-VTCSV-DRNAYVWTQGDDGKWATTLV 461 KEGN W Q + +H + V I WAP+ + + C D N V++ DG W TT + Sbjct: 86 KEGNQNQWTQAHVFTDHKVSVNSIAWAPHELGLSLACGASDGNISVFSARADGGWDTTKI 145 Query: 462 LLRINRAATCVKWSP 506 T V W+P Sbjct: 146 DQAHPVGVTSVSWAP 160 Score = 33.5 bits (73), Expect = 0.14 Identities = 16/57 (28%), Positives = 25/57 (43%) Frame = +3 Query: 294 KEGNDWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVL 464 KEG W+ T L + V + W+ N + + N VW + DG+W V+ Sbjct: 245 KEGEQWEGTV-LKDFKTPVWRVSWSLTGNLLAVSDGNNNVTVWKESVDGEWEQVTVV 300 Score = 31.5 bits (68), Expect = 0.57 Identities = 23/84 (27%), Positives = 34/84 (40%), Gaps = 6/84 (7%) Frame = +3 Query: 270 NNEVHIYKKEGNDWKQT--NNLVEHDLRVMGIDWAPNT----NRIVTCSVDRNAYVWTQG 431 ++ V ++K WK L +H V + WAPN + I + S D +WT G Sbjct: 185 DSTVKVWKFSNGSWKMDCFPALNKHTDWVRDVAWAPNLGLPKSTIASGSEDGKVIIWTIG 244 Query: 432 DDGKWATTLVLLRINRAATCVKWS 503 +G+ VL V WS Sbjct: 245 KEGEQWEGTVLKDFKTPVWRVSWS 268 Score = 29.9 bits (64), Expect = 1.7 Identities = 16/67 (23%), Positives = 27/67 (40%), Gaps = 2/67 (2%) Frame = +3 Query: 327 LVEHDLRVMGIDWA-PNTNRIV-TCSVDRNAYVWTQGDDGKWATTLVLLRINRAATCVKW 500 L H V + WA P ++ +CS D +W +G+ +W V + + W Sbjct: 52 LTGHRGPVWQVAWAHPKFGSLLASCSYDGQIILWKEGNQNQWTQAHVFTDHKVSVNSIAW 111 Query: 501 SPMRTSL 521 +P L Sbjct: 112 APHELGL 118 >At2g30050.1 68415.m03654 transducin family protein / WD-40 repeat family protein similar to SEC13-related protein (SP:P55735) [Homo sapiens] Length = 302 Score = 40.3 bits (90), Expect = 0.001 Identities = 26/75 (34%), Positives = 35/75 (46%), Gaps = 4/75 (5%) Frame = +3 Query: 294 KEGND--WKQTNNLVEHDLRVMGIDWAPNTNRI-VTC-SVDRNAYVWTQGDDGKWATTLV 461 KEGN W Q + +H V I WAP+ + + C S D N V+T DG W T+ + Sbjct: 86 KEGNQNQWTQDHVFTDHKSSVNSIAWAPHDIGLSLACGSSDGNISVFTARADGGWDTSRI 145 Query: 462 LLRINRAATCVKWSP 506 T V W+P Sbjct: 146 DQAHPVGVTSVSWAP 160 Score = 33.1 bits (72), Expect = 0.19 Identities = 24/84 (28%), Positives = 34/84 (40%), Gaps = 6/84 (7%) Frame = +3 Query: 270 NNEVHIYKKEGNDWKQT--NNLVEHDLRVMGIDWAPNT----NRIVTCSVDRNAYVWTQG 431 +N V ++K WK L +H V + WAPN + I + S D +WT G Sbjct: 185 DNTVKVWKLANGSWKMDCFPALQKHTDWVRDVAWAPNLGLPKSTIASGSQDGKVIIWTVG 244 Query: 432 DDGKWATTLVLLRINRAATCVKWS 503 +G+ VL V WS Sbjct: 245 KEGEQWEGKVLKDFMTPVWRVSWS 268 Score = 32.3 bits (70), Expect = 0.33 Identities = 17/67 (25%), Positives = 28/67 (41%), Gaps = 2/67 (2%) Frame = +3 Query: 312 KQTNNLVEHDLRVMGIDWA-PNTNRIV-TCSVDRNAYVWTQGDDGKWATTLVLLRINRAA 485 +Q L H V + WA P I+ +CS D +W +G+ +W V + Sbjct: 47 QQLATLTGHRGPVWEVAWAHPKYGSILASCSYDGQVILWKEGNQNQWTQDHVFTDHKSSV 106 Query: 486 TCVKWSP 506 + W+P Sbjct: 107 NSIAWAP 113 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/51 (27%), Positives = 22/51 (43%) Frame = +3 Query: 294 KEGNDWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKW 446 KEG W + L + V + W+ N + + N VW + DG+W Sbjct: 245 KEGEQW-EGKVLKDFMTPVWRVSWSLTGNLLAVSDGNNNVTVWKEAVDGEW 294 >At2g01330.1 68415.m00050 transducin family protein / WD-40 repeat family protein contains 10 WD-40 repeats (PF00400); similar to 66kDa stress protein (SWISS-PROT: P90587)[ Physarum polycephalum (Slime mold)] Length = 474 Score = 37.1 bits (82), Expect = 0.011 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = +3 Query: 336 HDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDG 440 H + + W+P++ R++T S D++A VW +DG Sbjct: 95 HKGSIYAVSWSPDSKRVLTVSADKSAKVWEVAEDG 129 Score = 33.9 bits (74), Expect = 0.11 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = +3 Query: 270 NNEVHIYKKEGNDWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVW 422 N E ++ +E K NN++ H R+ + W+PN + T S+D V+ Sbjct: 377 NREAVVWDRETKQVK-LNNMLFHTARINSLAWSPNNKMVATGSIDTCVIVY 426 >At4g34460.2 68417.m04898 guanine nucleotide-binding protein beta subunit (GB1) / GTP-binding protein beta subunit (AGB1) / transducin contains 7 WD-40 repeats (PF00400); identical to Guanine nucleotide-binding protein beta subunit.SP:P49177 [Arabidopsis thaliana]; Weiss, CA et al, PNAS 91:9954 (1994) Length = 315 Score = 35.9 bits (79), Expect = 0.027 Identities = 23/64 (35%), Positives = 29/64 (45%) Frame = +3 Query: 339 DLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVLLRINRAATCVKWSPMRTS 518 DL+V +DW P NRIV+ S D VW K T + L TC +SP S Sbjct: 3 DLQVYSLDWTPERNRIVSASQDGRLIVWNALTSQK--THAIKLPCAWVMTCA-FSPNGQS 59 Query: 519 LLSG 530 + G Sbjct: 60 VACG 63 >At4g32990.1 68417.m04692 transducin family protein / WD-40 repeat family protein HIRA protein, Drosophila melanogaster, PID:e1250847 Length = 318 Score = 34.7 bits (76), Expect = 0.061 Identities = 18/83 (21%), Positives = 36/83 (43%), Gaps = 2/83 (2%) Frame = +3 Query: 285 IYKKEGNDWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVW--TQGDDGKWATTL 458 +++ D + + L H+ V + W + + + TC D++ ++W +D ++ T Sbjct: 74 VWENFATDSESVSVLRGHESEVKSVSWNASGSLLATCGRDKSVWIWEIQPEEDDEFDTIA 133 Query: 459 VLLRINRAATCVKWSPMRTSLLS 527 VL + V W P L S Sbjct: 134 VLTGHSEDVKMVLWHPTMDVLFS 156 Score = 33.5 bits (73), Expect = 0.14 Identities = 17/74 (22%), Positives = 32/74 (43%), Gaps = 1/74 (1%) Frame = +3 Query: 285 IYKKEGNDWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVW-TQGDDGKWATTLV 461 I +E +++ L H V + W P + + +CS D +W ++ +DG + Sbjct: 121 IQPEEDDEFDTIAVLTGHSEDVKMVLWHPTMDVLFSCSYDNTIKIWCSEDEDGDYNCVQT 180 Query: 462 LLRINRAATCVKWS 503 L +N + WS Sbjct: 181 LSELNNGHSSTVWS 194 Score = 28.7 bits (61), Expect = 4.0 Identities = 11/40 (27%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = +3 Query: 312 KQTNNLVEHDLRVMGIDWAPNTNRIV-TCSVDRNAYVWTQ 428 ++ L H RV + W P + ++ +CS D+ +W Q Sbjct: 11 EEVQKLEGHTDRVWNVAWNPAADGVIASCSADKTVRIWEQ 50 >At4g34460.3 68417.m04900 guanine nucleotide-binding protein beta subunit (GB1) / GTP-binding protein beta subunit (AGB1) / transducin contains 7 WD-40 repeats (PF00400); identical to Guanine nucleotide-binding protein beta subunit.SP:P49177 [Arabidopsis thaliana]; Weiss, CA et al, PNAS 91:9954 (1994) Length = 347 Score = 33.5 bits (73), Expect = 0.14 Identities = 22/65 (33%), Positives = 28/65 (43%) Frame = +3 Query: 336 HDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVLLRINRAATCVKWSPMRT 515 H +V +DW P NRIV+ S D VW K T + L TC +SP Sbjct: 64 HTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQK--THAIKLPCAWVMTCA-FSPNGQ 120 Query: 516 SLLSG 530 S+ G Sbjct: 121 SVACG 125 >At4g34460.1 68417.m04899 guanine nucleotide-binding protein beta subunit (GB1) / GTP-binding protein beta subunit (AGB1) / transducin contains 7 WD-40 repeats (PF00400); identical to Guanine nucleotide-binding protein beta subunit.SP:P49177 [Arabidopsis thaliana]; Weiss, CA et al, PNAS 91:9954 (1994) Length = 377 Score = 33.5 bits (73), Expect = 0.14 Identities = 22/65 (33%), Positives = 28/65 (43%) Frame = +3 Query: 336 HDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVLLRINRAATCVKWSPMRT 515 H +V +DW P NRIV+ S D VW K T + L TC +SP Sbjct: 64 HTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQK--THAIKLPCAWVMTCA-FSPNGQ 120 Query: 516 SLLSG 530 S+ G Sbjct: 121 SVACG 125 >At3g18060.1 68416.m02297 transducin family protein / WD-40 repeat family protein similar to 66 kDa stress protein (SP:P90587) [Physarum polycephalum (Slime mold)]; similar to WDR1 protein GB:AAD05042 [Gallus gallus] (Genomics 56 (1), 59-69 (1999)); contains 11 WD-40 repeats (PF00400) Length = 609 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/43 (25%), Positives = 23/43 (53%) Frame = +3 Query: 336 HDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVL 464 H + + W+P+ +++T S D++A +W D+G + L Sbjct: 231 HKGSIYAVSWSPDGKQVLTVSADKSAKIWDISDNGSGSLNTTL 273 >At5g43920.1 68418.m05372 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to will die slowly protein (WDS) (SP:Q9V3J8) [Drosophila melanogaster] Length = 523 Score = 32.7 bits (71), Expect = 0.25 Identities = 20/67 (29%), Positives = 28/67 (41%) Frame = +3 Query: 327 LVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVLLRINRAATCVKWSP 506 LV H V + ++ + + T S D A +W DD K L + V WSP Sbjct: 220 LVAHKNEVWFVQFSNSGKYLATASSDCTAIIWKVLDDNKVELKHTLESHQNPVSFVSWSP 279 Query: 507 MRTSLLS 527 T LL+ Sbjct: 280 DDTKLLT 286 >At1g49540.1 68414.m05553 transducin family protein / WD-40 repeat family protein similar to signal transducer and activator of transcription interacting protein 1 (GI:15929722) {Mus musculus}; similar to hypothetical protein GB:AAD43147 GI:5430747 from (Arabidopsis thaliana); contains Pfam PF00400: WD domain, G-beta repeat (11 copies, 2 weak) Length = 840 Score = 32.7 bits (71), Expect = 0.25 Identities = 16/65 (24%), Positives = 28/65 (43%) Frame = +3 Query: 336 HDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVLLRINRAATCVKWSPMRT 515 H + W P ++ T S D+ +W+ +D + LVL + T V W+ + Sbjct: 695 HKRIIWACSWNPFGHQFATSSRDKTVKIWSVENDARIKQILVLPPFGSSVTAVAWTGLDR 754 Query: 516 SLLSG 530 + SG Sbjct: 755 NEKSG 759 >At3g44530.1 68416.m04786 transducin family protein / WD-40 repeat family protein contains 6 (4 significant) WD-40 repeats (PF0400); nuclear protein HIRA, mouse, PIR:S68141 Length = 1051 Score = 32.3 bits (70), Expect = 0.33 Identities = 10/39 (25%), Positives = 22/39 (56%) Frame = +3 Query: 306 DWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVW 422 +WK L H V+ ++W+P+ + + + S+D ++W Sbjct: 107 NWKAVMTLRGHTADVVDLNWSPDDSMLASGSLDNTVHIW 145 Score = 28.3 bits (60), Expect = 5.3 Identities = 21/70 (30%), Positives = 29/70 (41%), Gaps = 7/70 (10%) Frame = +3 Query: 270 NNEVHIYKKEGNDWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGD----- 434 +N VHI+ T L H V G+ W P + I + S D+ +W D Sbjct: 139 DNTVHIWNMRTG--MCTTVLRGHLSLVKGVTWDPIGSFIASQSDDKTVIIWRTSDWGMAH 196 Query: 435 --DGKWATTL 458 DG WA +L Sbjct: 197 RTDGHWAKSL 206 >At5g64630.3 68418.m08123 transducin family protein / WD-40 repeat family protein Similar to (SP:Q13112) Chromatin assembly factor 1 subunit B (CAF-1 subunit B) (CAF-Ip60) [Homo sapiens] Length = 428 Score = 31.9 bits (69), Expect = 0.43 Identities = 19/76 (25%), Positives = 34/76 (44%), Gaps = 1/76 (1%) Frame = +3 Query: 285 IYKKEGND-WKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLV 461 ++ E N WK +L H V+ + W+P+ +++ SVD + +W D K + + Sbjct: 34 LHPSETNQSWKVHKSLSFHRKDVLDLQWSPDDAYLISGSVDNSCIIW---DVNKGSVHQI 90 Query: 462 LLRINRAATCVKWSPM 509 L V W P+ Sbjct: 91 LDAHCHYVQGVAWDPL 106 >At5g64630.2 68418.m08122 transducin family protein / WD-40 repeat family protein Similar to (SP:Q13112) Chromatin assembly factor 1 subunit B (CAF-1 subunit B) (CAF-Ip60) [Homo sapiens] Length = 487 Score = 31.9 bits (69), Expect = 0.43 Identities = 19/76 (25%), Positives = 34/76 (44%), Gaps = 1/76 (1%) Frame = +3 Query: 285 IYKKEGND-WKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLV 461 ++ E N WK +L H V+ + W+P+ +++ SVD + +W D K + + Sbjct: 93 LHPSETNQSWKVHKSLSFHRKDVLDLQWSPDDAYLISGSVDNSCIIW---DVNKGSVHQI 149 Query: 462 LLRINRAATCVKWSPM 509 L V W P+ Sbjct: 150 LDAHCHYVQGVAWDPL 165 >At5g64630.1 68418.m08121 transducin family protein / WD-40 repeat family protein Similar to (SP:Q13112) Chromatin assembly factor 1 subunit B (CAF-1 subunit B) (CAF-Ip60) [Homo sapiens] Length = 397 Score = 31.9 bits (69), Expect = 0.43 Identities = 19/76 (25%), Positives = 34/76 (44%), Gaps = 1/76 (1%) Frame = +3 Query: 285 IYKKEGND-WKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLV 461 ++ E N WK +L H V+ + W+P+ +++ SVD + +W D K + + Sbjct: 93 LHPSETNQSWKVHKSLSFHRKDVLDLQWSPDDAYLISGSVDNSCIIW---DVNKGSVHQI 149 Query: 462 LLRINRAATCVKWSPM 509 L V W P+ Sbjct: 150 LDAHCHYVQGVAWDPL 165 >At5g13840.1 68418.m01618 WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similar to Fzr1 (GI:6463679){Homo sapiens} Length = 481 Score = 31.9 bits (69), Expect = 0.43 Identities = 18/69 (26%), Positives = 30/69 (43%) Frame = +3 Query: 321 NNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVLLRINRAATCVKW 500 + LV H V G+ W+ + + + D VW ++ L L A + W Sbjct: 292 SKLVGHKSEVCGLKWSHDDRELASGGNDNQLLVW---NNHSQQPILKLTEHTAAVKAITW 348 Query: 501 SPMRTSLLS 527 SP ++SLL+ Sbjct: 349 SPHQSSLLA 357 >At4g29730.1 68417.m04233 WD-40 repeat family protein contains 5 WD-40 repeats (PF0400); similar to WD-40 repeat protein MSI4 (SP:O22607) [Arabidopsis thaliana] Length = 496 Score = 31.5 bits (68), Expect = 0.57 Identities = 19/73 (26%), Positives = 33/73 (45%), Gaps = 4/73 (5%) Frame = +3 Query: 336 HDLRVMGIDWAPNTNRIV-TCSVDRNAYVWTQGD---DGKWATTLVLLRINRAATCVKWS 503 HD + +DW P+ N ++ T S D V+ + + +G + A CV+WS Sbjct: 325 HDADLHCVDWNPHDNNLILTGSADNTVRVFDRRNLTSNGVGSPVYKFEGHRAAVLCVQWS 384 Query: 504 PMRTSLLSGQELD 542 P ++S+ D Sbjct: 385 PDKSSVFGSSAED 397 Score = 29.5 bits (63), Expect = 2.3 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = +1 Query: 628 IDWHPN-NILLVAGSADFKVRVF 693 +DW+P+ N L++ GSAD VRVF Sbjct: 332 VDWNPHDNNLILTGSADNTVRVF 354 >At5g13480.1 68418.m01554 WD-40 repeat family protein similar to WD-repeat protein WDC146 (SP:Q9C0J8|) {Homo sapiens}; contains 3 weak Pfam PF00400: WD domain, G-beta repeats; Length = 711 Score = 31.1 bits (67), Expect = 0.75 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +1 Query: 619 VTSIDWHPNNILLVAGSADFKVRVF 693 V S+DWHP LLV+G D V+++ Sbjct: 271 VKSVDWHPTKSLLVSGGKDQLVKLW 295 >At4g33270.1 68417.m04734 WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); WD-repeat protein -Daucus carota,PID:g2253631 Length = 457 Score = 31.1 bits (67), Expect = 0.75 Identities = 16/67 (23%), Positives = 31/67 (46%), Gaps = 3/67 (4%) Frame = +3 Query: 336 HDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVLLRINRAATCVK---WSP 506 H V G+ W+ + ++ + D ++W + +TT L R+ + VK W P Sbjct: 265 HTQEVCGLKWSGSGQQLASGGNDNVVHIWDRSVASSNSTTQWLHRLEEHTSAVKALAWCP 324 Query: 507 MRTSLLS 527 + +LL+ Sbjct: 325 FQANLLA 331 >At4g33260.1 68417.m04733 WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); WD-repeat protein -Daucus carota, PID:g2253631 Length = 447 Score = 31.1 bits (67), Expect = 0.75 Identities = 16/67 (23%), Positives = 31/67 (46%), Gaps = 3/67 (4%) Frame = +3 Query: 336 HDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVLLRINRAATCVK---WSP 506 H V G+ W+ + ++ + D ++W + +TT L R+ + VK W P Sbjct: 255 HTQEVCGLKWSGSGQQLASGGNDNVVHIWDRSVASSNSTTQWLHRLEEHTSAVKALAWCP 314 Query: 507 MRTSLLS 527 + +LL+ Sbjct: 315 FQANLLA 321 >At2g41500.1 68415.m05127 WD-40 repeat family protein / small nuclear ribonucleoprotein Prp4p-related similar to U4/U6 small nuclear ribonucleoprotein hPrp4 (GP:2708305) {Homo sapiens}; contains Pfam PF00400: WD domain, G-beta repeat (7 copies)|19877698|gb|AU238529.1|AU238529 Length = 554 Score = 31.1 bits (67), Expect = 0.75 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +3 Query: 300 GNDWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWT-QGDD 437 G D+ +L H+ +V +D +++ I T S DR +WT G+D Sbjct: 495 GRDFSLVKSLAGHESKVASLDITADSSCIATVSHDRTIKLWTSSGND 541 >At4g32551.1 68417.m04633 WD-40 repeat family protein (LEUNIG) contains seven G-protein beta WD-40 repeats; beta transducin-like protein, Podospora anserina, gb:L28125; contains Pfam profiles PF04503: Single-stranded DNA binding protein, SSDP; PF00400:WD domain, G-beta repeat; identical to cDNA LEUNIG (LEUNIG) GI:11141604 Length = 931 Score = 30.3 bits (65), Expect = 1.3 Identities = 18/77 (23%), Positives = 33/77 (42%) Frame = +3 Query: 312 KQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVLLRINRAATC 491 K L EH + I ++P+ R+ T S D+ VW D K + + + T Sbjct: 684 KPKTTLEEHTAMITDIRFSPSQLRLATSSFDKTVRVWDA--DNKGYSLRTFMGHSSMVTS 741 Query: 492 VKWSPMRTSLLSGQELD 542 + + P++ L+ + D Sbjct: 742 LDFHPIKDDLICSCDND 758 >At1g04510.1 68414.m00442 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similar to cell cycle control protein cwf8 (SP:O14011) [Schizosaccharomyces pombe (Fission yeast)] Length = 523 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/44 (25%), Positives = 23/44 (52%) Frame = +3 Query: 321 NNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWAT 452 + L H +V I + +T+ ++T S D+ +W +DG + + Sbjct: 258 STLTGHSKKVTSIKFVGDTDLVLTASSDKTVRIWGCSEDGNYTS 301 >At5g24320.2 68418.m02866 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 698 Score = 29.5 bits (63), Expect = 2.3 Identities = 17/66 (25%), Positives = 33/66 (50%) Frame = +3 Query: 312 KQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVLLRINRAATC 491 K + + H ++ I W+ N NR+++ SVD + +W G + L + N T Sbjct: 347 KPLHEFLGHSGDILDISWSKN-NRLLSASVDNSVRLWQIGCE----DCLGIFSHNNYVTS 401 Query: 492 VKWSPM 509 V+++P+ Sbjct: 402 VQFNPV 407 >At5g24320.1 68418.m02865 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 694 Score = 29.5 bits (63), Expect = 2.3 Identities = 17/66 (25%), Positives = 33/66 (50%) Frame = +3 Query: 312 KQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVLLRINRAATC 491 K + + H ++ I W+ N NR+++ SVD + +W G + L + N T Sbjct: 347 KPLHEFLGHSGDILDISWSKN-NRLLSASVDNSVRLWQIGCE----DCLGIFSHNNYVTS 401 Query: 492 VKWSPM 509 V+++P+ Sbjct: 402 VQFNPV 407 >At4g11920.1 68417.m01895 WD-40 repeat family protein contains 6 WD repeats (PF00400); similar to Fzr1 (GI:6463679) {Homo sapiens}; similar to WD repeat protein Srw1 -Schizosaccharomyces pombe,PID:d1023012 Length = 475 Score = 29.5 bits (63), Expect = 2.3 Identities = 30/129 (23%), Positives = 52/129 (40%), Gaps = 12/129 (9%) Frame = +3 Query: 177 NGTNVNFW*LMRADNMSCMEQ--------G*KSNAFSPNNNEVHIYKKEGNDWKQ-TNNL 329 +GT V W ++R N+ ME S+ S + + I +++ + + L Sbjct: 230 SGT-VQIWDVLRCKNIRTMEGHRLRVGALAWSSSVLSSGSRDKSILQRDIRTQEDHVSKL 288 Query: 330 VEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVLLRINRAATCVK---W 500 H + G+ W+ + + + D +VW Q +T +LR A VK W Sbjct: 289 KGHKSEICGLKWSSDNRELASGGNDNKLFVWNQ------HSTQPVLRFCEHAAAVKAIAW 342 Query: 501 SPMRTSLLS 527 SP LL+ Sbjct: 343 SPHHFGLLA 351 >At2g33340.2 68415.m04087 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to cell cycle control protein cwf8 (SP:O14011) [Schizosaccharomyces pombe (Fission yeast)] Length = 537 Score = 29.5 bits (63), Expect = 2.3 Identities = 10/43 (23%), Positives = 22/43 (51%) Frame = +3 Query: 321 NNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWA 449 + L H +V + + +++ ++T S D+ +W DG +A Sbjct: 258 STLTGHSKKVTSVKFVGDSDLVLTASADKTVRIWRNPGDGNYA 300 >At2g33340.1 68415.m04086 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to cell cycle control protein cwf8 (SP:O14011) [Schizosaccharomyces pombe (Fission yeast)] Length = 565 Score = 29.5 bits (63), Expect = 2.3 Identities = 10/43 (23%), Positives = 22/43 (51%) Frame = +3 Query: 321 NNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWA 449 + L H +V + + +++ ++T S D+ +W DG +A Sbjct: 258 STLTGHSKKVTSVKFVGDSDLVLTASADKTVRIWRNPGDGNYA 300 >At2g32700.5 68415.m04001 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 785 Score = 29.5 bits (63), Expect = 2.3 Identities = 11/42 (26%), Positives = 21/42 (50%) Frame = +3 Query: 333 EHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTL 458 EH + + + PN+ ++ T S D+ +W D G + T+ Sbjct: 548 EHAHIITDVRFRPNSTQLATSSFDKTIKIWDASDPGYFLRTI 589 >At2g32700.4 68415.m04000 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 29.5 bits (63), Expect = 2.3 Identities = 11/42 (26%), Positives = 21/42 (50%) Frame = +3 Query: 333 EHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTL 458 EH + + + PN+ ++ T S D+ +W D G + T+ Sbjct: 550 EHAHIITDVRFRPNSTQLATSSFDKTIKIWDASDPGYFLRTI 591 >At2g32700.3 68415.m03999 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 29.5 bits (63), Expect = 2.3 Identities = 11/42 (26%), Positives = 21/42 (50%) Frame = +3 Query: 333 EHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTL 458 EH + + + PN+ ++ T S D+ +W D G + T+ Sbjct: 550 EHAHIITDVRFRPNSTQLATSSFDKTIKIWDASDPGYFLRTI 591 >At2g32700.2 68415.m03998 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 29.5 bits (63), Expect = 2.3 Identities = 11/42 (26%), Positives = 21/42 (50%) Frame = +3 Query: 333 EHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTL 458 EH + + + PN+ ++ T S D+ +W D G + T+ Sbjct: 550 EHAHIITDVRFRPNSTQLATSSFDKTIKIWDASDPGYFLRTI 591 >At2g32700.1 68415.m03997 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 29.5 bits (63), Expect = 2.3 Identities = 11/42 (26%), Positives = 21/42 (50%) Frame = +3 Query: 333 EHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTL 458 EH + + + PN+ ++ T S D+ +W D G + T+ Sbjct: 550 EHAHIITDVRFRPNSTQLATSSFDKTIKIWDASDPGYFLRTI 591 >At5g67320.1 68418.m08490 WD-40 repeat family protein strong similarity to unknown protein (ref|NP_005638.1) Length = 613 Score = 29.1 bits (62), Expect = 3.0 Identities = 19/85 (22%), Positives = 39/85 (45%), Gaps = 1/85 (1%) Frame = +3 Query: 255 AFSPNNNEVHIYKKEGNDWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGD 434 +F+ ++ + IY + + + H V + W P + + +CS D A +W Sbjct: 420 SFATSSTDSMIYLCKIGETRPAKTFTGHQGEVNCVKWDPTGSLLASCSDDSTAKIW---- 475 Query: 435 DGKWATTLVLLRIN-RAATCVKWSP 506 + K +T + LR + + ++WSP Sbjct: 476 NIKQSTFVHDLREHTKEIYTIRWSP 500 >At5g25150.1 68418.m02981 transducin family protein / WD-40 repeat family protein similar to TBP-associated factor (GI:1732075) [Homo sapiens] and to 100 kDa subunit of Pol II transcription factor (GI:1491718) {Homo sapiens]; contains Pfam PF00400: WD domain, G-beta repeat (6 copies)|8689032|gb|AV528749.1|AV528749 Length = 666 Score = 29.1 bits (62), Expect = 3.0 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +1 Query: 619 VTSIDWHPNNILLVAGSADFKVRVF 693 ++ +DWHPN + GS+D VR++ Sbjct: 502 LSDVDWHPNCNYIATGSSDKTVRLW 526 Score = 28.3 bits (60), Expect = 5.3 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 357 IDWAPNTNRIVTCSVDRNAYVW 422 +DW PN N I T S D+ +W Sbjct: 505 VDWHPNCNYIATGSSDKTVRLW 526 >At5g08560.1 68418.m01018 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to will die slowly protein (WDS) (SP:Q9V3J8) [Drosophila melanogaster] Length = 589 Score = 29.1 bits (62), Expect = 3.0 Identities = 16/65 (24%), Positives = 30/65 (46%), Gaps = 1/65 (1%) Frame = +3 Query: 315 QTNNLVE-HDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVLLRINRAATC 491 QT ++E H V + ++ N + + S D+ A +W DG + L+ ++ Sbjct: 265 QTAQILESHTDEVWFLQFSHNGKYLASSSKDQTAIIWEISADGHISLKHTLVGHHKPVIA 324 Query: 492 VKWSP 506 + WSP Sbjct: 325 ILWSP 329 >At4g00090.1 68417.m00009 transducin family protein / WD-40 repeat family protein similar to Transducin beta-like 2 protein (WS beta-transducin repeats protein) (WS-betaTRP) (Williams-Beuren syndrome chromosome region 13 protein) (SP:Q9Y4P3) {Homo sapiens} Length = 430 Score = 29.1 bits (62), Expect = 3.0 Identities = 14/48 (29%), Positives = 27/48 (56%), Gaps = 2/48 (4%) Frame = +3 Query: 285 IYKKEGN--DWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVW 422 +Y+K+G+ + + L H V + ++PN+ +I+T S D + VW Sbjct: 269 VYQKDGSVKEVSRVMQLKGHKSAVTWLCFSPNSEQIITASKDGSIRVW 316 >At5g26900.1 68418.m03208 WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to fizzy1 (GI:3298595) {Xenopus laevis}; WD-repeat protein, carrot, PIR:T14352 Length = 444 Score = 28.7 bits (61), Expect = 4.0 Identities = 20/82 (24%), Positives = 35/82 (42%), Gaps = 7/82 (8%) Frame = +3 Query: 303 NDWKQTNNLVE----HDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVLLR 470 ND + +++VE H V G+ W+ + N+ + D ++W + T L R Sbjct: 236 NDVRIRSSIVETYLGHTEEVCGLKWSESGNKQASGGNDNVVHIWDRSLASSKQTRQWLHR 295 Query: 471 INRAATCVK---WSPMRTSLLS 527 V+ W P + SLL+ Sbjct: 296 FEEHTAAVRALAWCPFQASLLA 317 >At5g23430.2 68418.m02749 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 836 Score = 28.7 bits (61), Expect = 4.0 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +1 Query: 619 VTSIDWHPNNILLVAGSADFKVR 687 + S+D+HP+ LL GSAD V+ Sbjct: 188 IQSLDFHPHEFLLATGSADRTVK 210 >At5g23430.1 68418.m02748 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 837 Score = 28.7 bits (61), Expect = 4.0 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +1 Query: 619 VTSIDWHPNNILLVAGSADFKVR 687 + S+D+HP+ LL GSAD V+ Sbjct: 188 IQSLDFHPHEFLLATGSADRTVK 210 >At5g08390.1 68418.m00988 transducin family protein / WD-40 repeat family protein similar to katanin p80 subunit [Strongylocentrotus purpuratus] GI:3005601; contains Pfam profile PF00400: WD domain, G-beta repeat Length = 871 Score = 28.7 bits (61), Expect = 4.0 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +1 Query: 619 VTSIDWHPNNILLVAGSADFKVR 687 + S+D+HP+ LL GSAD V+ Sbjct: 281 IQSLDFHPHEFLLATGSADKTVK 303 >At4g29860.1 68417.m04250 transducin family protein / WD-40 repeat family protein contains 3 WD-40 repeats (PF00400); WDVCF variant 1 (gi:12006981) [Mus musculus] Length = 386 Score = 28.7 bits (61), Expect = 4.0 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +1 Query: 610 RSTVTSIDWHPNNILLVAGSADFKVRVF 693 R +V + +HP+ LL GSAD ++R++ Sbjct: 17 RHSVMDVSFHPSKSLLFTGSADGELRIW 44 >At2g19520.1 68415.m02281 WD-40 repeat protein (MSI4) contains 6 (4 significant) WD-40 repeats (PF0400); identical to WD-40 repeat protein MSI4 (SP:O22607) [Arabidopsis thaliana] Length = 507 Score = 28.3 bits (60), Expect = 5.3 Identities = 19/73 (26%), Positives = 32/73 (43%), Gaps = 4/73 (5%) Frame = +3 Query: 336 HDLRVMGIDWAPNT-NRIVTCSVDRNAYVWTQGD---DGKWATTLVLLRINRAATCVKWS 503 HD + +DW P+ N I+T S D ++ + +G + A CV+WS Sbjct: 336 HDADLHCVDWNPHDDNLILTGSADNTVRLFDRRKLTANGVGSPIYKFEGHKAAVLCVQWS 395 Query: 504 PMRTSLLSGQELD 542 P ++S+ D Sbjct: 396 PDKSSVFGSSAED 408 >At4g26400.2 68417.m03800 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 356 Score = 27.9 bits (59), Expect = 7.0 Identities = 18/49 (36%), Positives = 21/49 (42%) Frame = -2 Query: 527 RQQTCSHGRPFHASRCSVDTQKNKSSCPFPIISLSPDVSITVNRTRNNT 381 ++ C H FH RC V + SSCP L PD VN R T Sbjct: 255 KEMPCKH--KFHI-RCIVPWLELHSSCPVCRYELPPDDETKVNPVRPRT 300 >At4g26400.1 68417.m03799 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 356 Score = 27.9 bits (59), Expect = 7.0 Identities = 18/49 (36%), Positives = 21/49 (42%) Frame = -2 Query: 527 RQQTCSHGRPFHASRCSVDTQKNKSSCPFPIISLSPDVSITVNRTRNNT 381 ++ C H FH RC V + SSCP L PD VN R T Sbjct: 255 KEMPCKH--KFHI-RCIVPWLELHSSCPVCRYELPPDDETKVNPVRPRT 300 >At5g56130.1 68418.m07002 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to beta transducin-like protein HET-E2C*4 (GI:17225206) [Podospora anserina] Length = 315 Score = 27.5 bits (58), Expect = 9.3 Identities = 16/65 (24%), Positives = 28/65 (43%), Gaps = 1/65 (1%) Frame = +3 Query: 336 HDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDG-KWATTLVLLRINRAATCVKWSPMR 512 H +V + W N ++ + SVD+ A +W G A L L + + W P Sbjct: 19 HKKKVHSVAWNSNGTKLASGSVDQTARIWNIEPHGHSKAKDLELKGHTDSVDQLCWDPKH 78 Query: 513 TSLLS 527 + L++ Sbjct: 79 SDLVA 83 >At5g32070.1 68418.m03689 hypothetical protein Length = 339 Score = 27.5 bits (58), Expect = 9.3 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = +3 Query: 249 SNAFSPNNNEVHIYKKEGNDWKQTNNLVEHDLRVMGIDWAPNTNR 383 S S ++ I K+GN KQT N+V +++ + + P T+R Sbjct: 294 SRVTSKKGLKILILDKDGNIQKQTTNIVFYEVLHSQLKFNPTTSR 338 >At5g27945.1 68418.m03364 transducin family protein / WD-40 repeat family protein fizzy-related (FZR); contains 6 WD-40 repeats (PF00400); WD-repeat protein, carrot,(gi:2253631) PIR:T14352 Length = 428 Score = 27.5 bits (58), Expect = 9.3 Identities = 16/69 (23%), Positives = 28/69 (40%), Gaps = 3/69 (4%) Frame = +3 Query: 330 VEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVLLRINRAATCVK---W 500 V H V G+ W+ + ++ + D ++W + T L R V+ W Sbjct: 233 VGHTEEVCGLKWSESGKKLASGGNDNVVHIWDRSLASSNPTRQWLHRFEEHTAAVRALAW 292 Query: 501 SPMRTSLLS 527 P + SLL+ Sbjct: 293 CPFQASLLA 301 >At3g27640.1 68416.m03452 transducin family protein / WD-40 repeat family protein contains seven WD-40 G-protein beta repeats; similar to RA-regulated nuclear matrix-associated protein (GI:14161320) {Homo sapiens} Length = 535 Score = 27.5 bits (58), Expect = 9.3 Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = +3 Query: 336 HDLRVMGIDWAPN-TNRIVTCSVDRNAYVW 422 HD V +DW+P+ ++ T S D +W Sbjct: 380 HDFEVTAVDWSPSEIGKVATASDDFTVRLW 409 >At3g21540.1 68416.m02717 transducin family protein / WD-40 repeat family protein contains Pfam profile: PF00400 WD domain, G-beta repeat (10 copies); similar to WD-repeat protein 3 (SP:Q9UNX4) [Homo sapiens] Length = 955 Score = 27.5 bits (58), Expect = 9.3 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +3 Query: 324 NLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVW 422 +L H L VM ID + + IVT S D+N +W Sbjct: 577 SLYGHKLPVMCIDISSDGELIVTGSQDKNLKIW 609 >At3g15980.3 68416.m02022 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); identical to coatomer protein complex, beta prime (beta'-COP) protein {Arabidopsis thaliana} (GI:9294445); similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:P35606) [Homo sapiens] Length = 918 Score = 27.5 bits (58), Expect = 9.3 Identities = 14/44 (31%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +3 Query: 303 NDWKQTNNLVEHDLRVMGIDWAP-NTNRIVTCSVDRNAYVWTQG 431 N W T H VM + + P +TN + S+DR +W G Sbjct: 130 NGWACTQIFEGHSHYVMQVVFNPKDTNTFASASLDRTIKIWNLG 173 >At3g15980.2 68416.m02021 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); identical to coatomer protein complex, beta prime (beta'-COP) protein {Arabidopsis thaliana} (GI:9294445); similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:P35606) [Homo sapiens] Length = 918 Score = 27.5 bits (58), Expect = 9.3 Identities = 14/44 (31%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +3 Query: 303 NDWKQTNNLVEHDLRVMGIDWAP-NTNRIVTCSVDRNAYVWTQG 431 N W T H VM + + P +TN + S+DR +W G Sbjct: 130 NGWACTQIFEGHSHYVMQVVFNPKDTNTFASASLDRTIKIWNLG 173 >At3g15980.1 68416.m02020 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); identical to coatomer protein complex, beta prime (beta'-COP) protein {Arabidopsis thaliana} (GI:9294445); similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:P35606) [Homo sapiens] Length = 909 Score = 27.5 bits (58), Expect = 9.3 Identities = 14/44 (31%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +3 Query: 303 NDWKQTNNLVEHDLRVMGIDWAP-NTNRIVTCSVDRNAYVWTQG 431 N W T H VM + + P +TN + S+DR +W G Sbjct: 130 NGWACTQIFEGHSHYVMQVVFNPKDTNTFASASLDRTIKIWNLG 173 >At2g37670.1 68415.m04620 WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similiar to rab11 binding protein (GI:4512103) [Bos taurus] Length = 903 Score = 27.5 bits (58), Expect = 9.3 Identities = 18/77 (23%), Positives = 36/77 (46%) Frame = +3 Query: 312 KQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVLLRINRAATC 491 K +L H ++ + W+ + +++ S+D+ +W D + T L L N TC Sbjct: 497 KPVCSLKGHLDAILDLSWS-KSQLLLSSSMDKTVRLW----DIETKTCLKLFAHNDYVTC 551 Query: 492 VKWSPMRTSLLSGQELD 542 +++SP+ + LD Sbjct: 552 IQFSPVDENYFLSGSLD 568 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,567,063 Number of Sequences: 28952 Number of extensions: 339798 Number of successful extensions: 1043 Number of sequences better than 10.0: 57 Number of HSP's better than 10.0 without gapping: 921 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1030 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1535986264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -