BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021051 (768 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L07880-1|AAA29358.1| 218|Anopheles gambiae glutathione S-transf... 25 1.9 AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 25 2.6 AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CY... 23 7.9 AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical prote... 23 7.9 AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical prote... 23 7.9 >L07880-1|AAA29358.1| 218|Anopheles gambiae glutathione S-transferase protein. Length = 218 Score = 25.4 bits (53), Expect = 1.9 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -1 Query: 714 RSKLTCNVGFDVAMEVYKMRWNGKPLHFL 628 RS L CN+ D + + ++ G+PL FL Sbjct: 8 RSSLKCNIMPDYKVYYFNVKALGEPLRFL 36 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 25.0 bits (52), Expect = 2.6 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = +3 Query: 201 FQPDLFVECINLNEYSQLPTRLKLSS 278 F +LF+E + ++S + LKL+S Sbjct: 223 FNEELFIEALRFGDFSNTSSALKLAS 248 >AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CYP12F2 protein. Length = 522 Score = 23.4 bits (48), Expect = 7.9 Identities = 11/47 (23%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = -1 Query: 768 NPVVVISAGLAGKAHAGQR-SKLTCNVGFDVAMEVYKMRWNGKPLHF 631 NP + + G ++ G+R + + + + +++RWN LHF Sbjct: 455 NPFIFLPFGFGARSCIGRRLAMMELEMITARLVRQFELRWNYDKLHF 501 >AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 23.4 bits (48), Expect = 7.9 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = +3 Query: 201 FQPDLFVECINLNEYSQLPTRLKLSSKRTQIVRIPTGGTL 320 F P + +E L + ++L +LS++RT+ PTG +L Sbjct: 267 FDPIVLLELCKLRKETELRRLERLSTQRTKRDFHPTGCSL 306 >AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 23.4 bits (48), Expect = 7.9 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = +3 Query: 201 FQPDLFVECINLNEYSQLPTRLKLSSKRTQIVRIPTGGTL 320 F P + +E L + ++L +LS++RT+ PTG +L Sbjct: 267 FDPIVLLELCKLRKETELRRLERLSTQRTKRDFHPTGCSL 306 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 883,446 Number of Sequences: 2352 Number of extensions: 18988 Number of successful extensions: 40 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79834176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -