BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021050 (777 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 25 2.6 AF378002-1|AAL16724.1| 336|Anopheles gambiae putative transposa... 23 8.0 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 25.0 bits (52), Expect = 2.6 Identities = 11/40 (27%), Positives = 20/40 (50%) Frame = +2 Query: 260 QLPLHPKKKVKTLEDETSSLDVSFCDDEALPPGIVFTDIQ 379 ++ L P ++++ D + +CD A PP I F D + Sbjct: 58 EVSLEPGQRIRRELDPCCEILRLYCDTSACPPLIEFCDAE 97 >AF378002-1|AAL16724.1| 336|Anopheles gambiae putative transposase protein. Length = 336 Score = 23.4 bits (48), Expect = 8.0 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 209 YSKVIVCWNAAAGTRFVQLPLHP 277 YSKV+ W A G FV L+P Sbjct: 245 YSKVVREWYAEKGVLFVPKNLNP 267 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 785,483 Number of Sequences: 2352 Number of extensions: 15909 Number of successful extensions: 39 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81081585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -