BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021049 (730 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 23 1.9 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 23 1.9 AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory recept... 22 4.4 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 22 5.8 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 21 7.7 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 23.4 bits (48), Expect = 1.9 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +3 Query: 168 LLTFLLTTASSVLLFTLGYYYIDIR*QDGGLLEQSIL 278 +LT +LT A+ LLF L Y Y I+ L+ S L Sbjct: 3 VLTTVLTAAAVFLLFYLFYCYKTIKQHIYSLISLSYL 39 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 23.4 bits (48), Expect = 1.9 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +3 Query: 168 LLTFLLTTASSVLLFTLGYYYIDIR*QDGGLLEQSIL 278 +LT +LT A+ LLF L Y Y I+ L+ S L Sbjct: 3 VLTTVLTAAAVFLLFYLFYCYKTIKQHIYSLISLSYL 39 >AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory receptor candidate 55 protein. Length = 402 Score = 22.2 bits (45), Expect = 4.4 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -1 Query: 673 IHILVGSYLDLDLL*SIPLQMLELFH*FLQFAPL 572 +H L +Y +DL ++ L+L H +QF+ L Sbjct: 324 LHELRNNYFHMDLENNVQSYSLQLLHQKVQFSVL 357 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 21.8 bits (44), Expect = 5.8 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -3 Query: 728 NCSISLTCFSDSFNVVS 678 +CS+ TC SD +VS Sbjct: 454 DCSVYYTCVSDGSKLVS 470 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.4 bits (43), Expect = 7.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 326 EELSTTKTKLAGIEDNSF 379 EEL + +L + DNSF Sbjct: 45 EELDLSNNRLRNVPDNSF 62 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,247 Number of Sequences: 336 Number of extensions: 3162 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19467635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -