BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021044 (754 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 94 1e-19 SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 8e-17 SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) 67 2e-11 SB_43842| Best HMM Match : RNB (HMM E-Value=0) 57 2e-08 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) 53 3e-07 SB_37351| Best HMM Match : DEAD (HMM E-Value=0) 51 1e-06 SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) 50 2e-06 SB_52320| Best HMM Match : DEAD (HMM E-Value=0) 48 8e-06 SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) 45 6e-05 SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_9558| Best HMM Match : DEAD (HMM E-Value=0) 44 2e-04 SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) 43 3e-04 SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) 42 7e-04 SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) 38 0.007 SB_17563| Best HMM Match : DEAD (HMM E-Value=0) 38 0.007 SB_2247| Best HMM Match : DEAD (HMM E-Value=0) 38 0.007 SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) 37 0.015 SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) 36 0.047 SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) 33 0.19 SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) 33 0.25 SB_26138| Best HMM Match : RhoGEF (HMM E-Value=0.0011) 31 0.76 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_50950| Best HMM Match : AAA_5 (HMM E-Value=0.0006) 29 4.1 SB_19342| Best HMM Match : Keratin_B2 (HMM E-Value=0.41) 29 4.1 SB_32980| Best HMM Match : DEAD (HMM E-Value=0) 29 5.4 SB_19782| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.4 SB_8125| Best HMM Match : MFS_1 (HMM E-Value=3.2e-07) 28 9.4 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 93.9 bits (223), Expect = 1e-19 Identities = 42/68 (61%), Positives = 53/68 (77%) Frame = +1 Query: 550 YILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTCVFGGAPK 729 +ILP IVHIN+QP ++ GDGPI LVL PTRELAQQ+Q+VA G +R+TC++GGAPK Sbjct: 113 FILPGIVHINHQPLLQPGDGPIVLVLCPTRELAQQVQEVAYSVGKHCKLRSTCIYGGAPK 172 Query: 730 REQARDLE 753 Q R+LE Sbjct: 173 GPQIRELE 180 Score = 57.6 bits (133), Expect = 1e-08 Identities = 26/56 (46%), Positives = 36/56 (64%) Frame = +3 Query: 312 RSPYEVEEYRNNHEVTVSGVEVHNSIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQ 479 R +EV+ YR + ++TV+G V + FEE+ FPDY+Q K G+ EPT IQAQ Sbjct: 57 RGQHEVDAYRRSKDLTVNGRNVPKPVTTFEESAFPDYIQSYFKREGFTEPTMIQAQ 112 >SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 790 Score = 84.6 bits (200), Expect = 8e-17 Identities = 40/77 (51%), Positives = 52/77 (67%) Frame = +1 Query: 523 QTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRN 702 +TGSGKT A++ PA+VHI +QP ++ GDGPI L+ APTREL QQI A FG + Sbjct: 562 KTGSGKTAAFLWPALVHIMDQPELQVGDGPIVLICAPTRELCQQIYTEARRFGKAYNIHV 621 Query: 703 TCVFGGAPKREQARDLE 753 VFGG K EQ++ L+ Sbjct: 622 VAVFGGGNKYEQSKALQ 638 Score = 69.3 bits (162), Expect = 3e-12 Identities = 30/90 (33%), Positives = 48/90 (53%) Frame = +3 Query: 240 PRLGFVSLQPFNKNFYDPHPTVLKRSPYEVEEYRNNHEVTVSGVEVHNSIQYFEEANFPD 419 P + +PFNKNFY+ HP + K+S E+++ R + VSG F F + Sbjct: 467 PEKSKIDYKPFNKNFYEEHPEITKQSKQEIDDLRKKMGIKVSGAMPARPCISFAHFGFDE 526 Query: 420 YVQQGVKTMGYKEPTPIQAQGWPIAMSGKN 509 + ++ + Y +PT IQ Q PIA+SG++ Sbjct: 527 QMMASIRKLEYTQPTQIQCQALPIALSGRD 556 >SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) Length = 428 Score = 66.9 bits (156), Expect = 2e-11 Identities = 35/73 (47%), Positives = 45/73 (61%), Gaps = 4/73 (5%) Frame = +1 Query: 523 QTGSGKTLAYILPAIVHINNQPPIRRGD----GPIALVLAPTRELAQQIQQVAADFGHTS 690 +TGSGKT A+ +P +V I P I R + GP AL+LAPTRELAQQI++ FG Sbjct: 146 ETGSGKTAAFAIPLLVWIMGLPKIERDNDADQGPYALILAPTRELAQQIEEEILKFGRPL 205 Query: 691 YVRNTCVFGGAPK 729 +R V GGA + Sbjct: 206 GIRTVSVIGGADR 218 Score = 46.4 bits (105), Expect = 2e-05 Identities = 19/58 (32%), Positives = 34/58 (58%) Frame = +3 Query: 336 YRNNHEVTVSGVEVHNSIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKN 509 +R + ++ G + I+ ++EA PD + + V +GYK+PTPIQ Q PI + ++ Sbjct: 83 FREDFNISTKGGRIPFPIRKWKEAQIPDSILEIVDKLGYKDPTPIQRQAIPIGLQNRD 140 >SB_43842| Best HMM Match : RNB (HMM E-Value=0) Length = 1238 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = +1 Query: 523 QTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQI 657 +TGSGKTLAY LP + + + P GD P+AL+L PTREL QQ+ Sbjct: 117 ETGSGKTLAYSLPLCMLLRTKAPSNPGDTPVALILTPTRELMQQV 161 Score = 43.2 bits (97), Expect = 2e-04 Identities = 22/80 (27%), Positives = 39/80 (48%) Frame = +3 Query: 270 FNKNFYDPHPTVLKRSPYEVEEYRNNHEVTVSGVEVHNSIQYFEEANFPDYVQQGVKTMG 449 F ++YD + V + S V+E R + + + G + I+ F + N P + + Sbjct: 32 FMWSYYDENEKVSRLSDEVVDEIRWKNGIHIEGEDCPKPIESFHDLNLPPELSTYLAKKN 91 Query: 450 YKEPTPIQAQGWPIAMSGKN 509 ++ PTPIQ Q MSG++ Sbjct: 92 FQVPTPIQMQSLSCVMSGRD 111 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 56.4 bits (130), Expect = 2e-08 Identities = 32/77 (41%), Positives = 42/77 (54%) Frame = +1 Query: 523 QTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRN 702 QTGSGKT AY+LP + + Q P+AL +APTRELA+QI A F + ++ Sbjct: 524 QTGSGKTAAYMLPVLTSLIKQGLNAPPRSPLALCVAPTRELAKQIYIEARKFSDHTPIKV 583 Query: 703 TCVFGGAPKREQARDLE 753 +GG QA LE Sbjct: 584 CVCYGGVSVPYQASQLE 600 Score = 39.1 bits (87), Expect = 0.004 Identities = 18/53 (33%), Positives = 27/53 (50%) Frame = +3 Query: 360 VSGVEVHNSIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKN*LA 518 VSG I F E F + + + GY+ PTP+Q PI M+G++ +A Sbjct: 469 VSGENQPPKITSFNELPFGEQLMANISRAGYRRPTPVQKAALPIVMAGRDLMA 521 >SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 56.4 bits (130), Expect = 2e-08 Identities = 30/89 (33%), Positives = 49/89 (55%), Gaps = 1/89 (1%) Frame = +3 Query: 255 VSLQPFNKNFYDPHPTVLKRSPYEVEEYRNNHE-VTVSGVEVHNSIQYFEEANFPDYVQQ 431 V QPF K+FY P + K +P E +E+R + E + V G ++ + + + Sbjct: 59 VVYQPFRKDFYVEVPELAKMTPEETDEFRLSLENIHVRGKNAPKPVKTWAQTGVQLKILD 118 Query: 432 GVKTMGYKEPTPIQAQGWPIAMSGKN*LA 518 +K Y++PTPIQAQ P+ MSG++ +A Sbjct: 119 VLKKNSYEKPTPIQAQAIPVIMSGRDMIA 147 Score = 45.2 bits (102), Expect = 6e-05 Identities = 26/72 (36%), Positives = 36/72 (50%) Frame = +1 Query: 538 KTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTCVFG 717 K +Y P + P I G IA+V+ PTRELA QI + F + +R CV+G Sbjct: 121 KKNSYEKPTPIQAQAIPVIMSGRDMIAIVMTPTRELAIQIHRECKKFCKPNNLRCVCVYG 180 Query: 718 GAPKREQARDLE 753 G EQ +L+ Sbjct: 181 GTGISEQIAELK 192 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 55.2 bits (127), Expect = 5e-08 Identities = 31/81 (38%), Positives = 41/81 (50%), Gaps = 4/81 (4%) Frame = +1 Query: 523 QTGSGKTLAYILPAIVHINN----QPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTS 690 QTGSGKT A++LP + + N P A+ +APTRELA QI A F H + Sbjct: 756 QTGSGKTAAFLLPVMTSMMNAGLTSSSFSETQTPQAMCIAPTRELANQIYLEARKFAHGT 815 Query: 691 YVRNTCVFGGAPKREQARDLE 753 +R +GG Q R L+ Sbjct: 816 MLRPVVCYGGVSVSHQLRQLQ 836 Score = 42.7 bits (96), Expect = 3e-04 Identities = 22/56 (39%), Positives = 31/56 (55%) Frame = +3 Query: 351 EVTVSGVEVHNSIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKN*LA 518 EV VSG I FEEAN + V+ YK+PTP+Q PI ++G++ +A Sbjct: 698 EVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGRDVMA 753 >SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 53.2 bits (122), Expect = 2e-07 Identities = 32/80 (40%), Positives = 43/80 (53%), Gaps = 1/80 (1%) Frame = +1 Query: 517 RTQTGSGKTLAYILPAIVHINNQPPIRRG-DGPIALVLAPTRELAQQIQQVAADFGHTSY 693 + Q+G+GKT + + + I+ + G D ALVLAPTRELAQQIQ+V G + Sbjct: 128 QAQSGTGKTATFAISILQEIDTNYKDKNGCDCCQALVLAPTRELAQQIQKVVLALGDYMH 187 Query: 694 VRNTCVFGGAPKREQARDLE 753 V+ GG RE LE Sbjct: 188 VKCHACIGGTNVREDRMKLE 207 >SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) Length = 500 Score = 52.8 bits (121), Expect = 3e-07 Identities = 23/75 (30%), Positives = 41/75 (54%) Frame = +3 Query: 285 YDPHPTVLKRSPYEVEEYRNNHEVTVSGVEVHNSIQYFEEANFPDYVQQGVKTMGYKEPT 464 Y HPT+ + +V++ R+ E+ V G V + + F +F + + + + GY PT Sbjct: 161 YKEHPTIAALTAEQVKQLRDKMEIKVKGEHVVSPVLEFFHCSFNESLSKNLSNHGYHSPT 220 Query: 465 PIQAQGWPIAMSGKN 509 PIQ Q P+ +SG++ Sbjct: 221 PIQMQVLPVLLSGRD 235 >SB_37351| Best HMM Match : DEAD (HMM E-Value=0) Length = 688 Score = 50.8 bits (116), Expect = 1e-06 Identities = 28/80 (35%), Positives = 46/80 (57%), Gaps = 1/80 (1%) Frame = +1 Query: 502 ERISWRTQTGSGKTLAYILPAIVHINN-QPPIRRGDGPIALVLAPTRELAQQIQQVAADF 678 E + + +TG+GKTL++ LP + + + + +RG P LV+APTRELA+Q+ + Sbjct: 111 EDVIGQARTGTGKTLSFALPLVEKLQDGKLSQKRGRAPKVLVMAPTRELAKQVGNEFENL 170 Query: 679 GHTSYVRNTCVFGGAPKREQ 738 S + C++GG P Q Sbjct: 171 --KSNLEVYCIYGGMPYEPQ 188 >SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) Length = 978 Score = 50.4 bits (115), Expect = 2e-06 Identities = 32/82 (39%), Positives = 43/82 (52%), Gaps = 5/82 (6%) Frame = +1 Query: 523 QTGSGKTLAYILPAIVHINNQPPIRRG-----DGPIALVLAPTRELAQQIQQVAADFGHT 687 QTGSGKTLAY+ P +VH + R G P A ++ P RELA QI + A H Sbjct: 423 QTGSGKTLAYLAP-LVHRLREDEERHGILARLKRPRACIVVPARELATQILKTAKSLCHH 481 Query: 688 SYVRNTCVFGGAPKREQARDLE 753 + R+ + GG ++ DLE Sbjct: 482 ARFRSVGLIGGRKQKWMRDDLE 503 >SB_52320| Best HMM Match : DEAD (HMM E-Value=0) Length = 340 Score = 48.0 bits (109), Expect = 8e-06 Identities = 31/75 (41%), Positives = 42/75 (56%), Gaps = 1/75 (1%) Frame = +1 Query: 523 QTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRN 702 +TGSGKTLA+++P I + Q DG ALV++PTRELA Q +V G+ + Sbjct: 95 KTGSGKTLAFLIPIIETLWRQKWTSM-DGLGALVISPTRELAYQTFEVLVKIGNKHDLSA 153 Query: 703 TCVFGGAP-KREQAR 744 + GG K EQ R Sbjct: 154 GLIIGGKDLKNEQKR 168 Score = 31.5 bits (68), Expect = 0.76 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +3 Query: 381 NSIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKN 509 + ++ F + G+ G+ PT IQ QG P+A+SG++ Sbjct: 47 SEVEKFSDFPISKRTLDGLMKAGFVTPTDIQKQGIPVALSGRD 89 >SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 370 Score = 45.6 bits (103), Expect = 4e-05 Identities = 30/79 (37%), Positives = 42/79 (53%) Frame = +1 Query: 517 RTQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYV 696 + Q+G+GKT + + + I+ Q +R P ALVL+PTRELA QIQ+V G V Sbjct: 40 QAQSGTGKTATFSISVLQAIDTQ--LRE---PQALVLSPTRELANQIQKVVLALGDYMSV 94 Query: 697 RNTCVFGGAPKREQARDLE 753 + GG E R L+ Sbjct: 95 QCHACIGGTNIGEDIRKLD 113 >SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) Length = 1058 Score = 45.2 bits (102), Expect = 6e-05 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 4/64 (6%) Frame = +3 Query: 324 EVEEYRNNHEVTVSGVEVHNSIQYF----EEANFPDYVQQGVKTMGYKEPTPIQAQGWPI 491 ++ +R+ + V G +V + ++ F E FPDY+ V+ GY PTPIQ Q P+ Sbjct: 137 KINLFRHEQHIYVKGADVPDPVETFSQLIERYGFPDYIIHNVQERGYTTPTPIQMQATPL 196 Query: 492 AMSG 503 G Sbjct: 197 MAHG 200 Score = 27.9 bits (59), Expect = 9.4 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 3/39 (7%) Frame = +1 Query: 550 YILPAIVHINNQPPIRRG---DGPIALVLAPTRELAQQI 657 Y P + + P + G G A+V++PTRELAQQI Sbjct: 183 YTTPTPIQMQATPLMAHGPKKSGFRAVVVSPTRELAQQI 221 >SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1448 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/77 (31%), Positives = 43/77 (55%) Frame = +1 Query: 523 QTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRN 702 +TGSGKTLA+++P +V + + + +G ++++PTREL+ Q VA D Sbjct: 617 KTGSGKTLAFLVP-VVELLYKLQFKTRNGTGVIIISPTRELSLQTYGVARDLLKHHNFTY 675 Query: 703 TCVFGGAPKREQARDLE 753 + GG ++ +A L+ Sbjct: 676 GIIMGGVNRKAEAERLQ 692 >SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 44.0 bits (99), Expect = 1e-04 Identities = 23/66 (34%), Positives = 38/66 (57%) Frame = +1 Query: 523 QTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRN 702 +TGSGKT A+++P + G AL+L+PTRELA Q Q+ + G + +++ Sbjct: 326 RTGSGKTAAFLIPMFEKLQTHTA---KVGIRALILSPTRELALQTQKFIKELGRFTGLKS 382 Query: 703 TCVFGG 720 + + GG Sbjct: 383 SVILGG 388 >SB_9558| Best HMM Match : DEAD (HMM E-Value=0) Length = 436 Score = 43.6 bits (98), Expect = 2e-04 Identities = 28/76 (36%), Positives = 38/76 (50%) Frame = +1 Query: 523 QTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRN 702 +TGSGKT A+ LP + + + P G A+VL PTRELA QI G ++ Sbjct: 52 KTGSGKTAAFALPILQKLCDDPY-----GIFAVVLTPTRELAFQIADQFKVLGRPIGLKE 106 Query: 703 TCVFGGAPKREQARDL 750 + GG +QA L Sbjct: 107 AVIVGGLDMMKQALSL 122 >SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) Length = 185 Score = 42.7 bits (96), Expect = 3e-04 Identities = 22/56 (39%), Positives = 31/56 (55%) Frame = +3 Query: 351 EVTVSGVEVHNSIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKN*LA 518 EV VSG I FEEAN + V+ YK+PTP+Q PI ++G++ +A Sbjct: 121 EVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGRDVMA 176 >SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) Length = 238 Score = 41.5 bits (93), Expect = 7e-04 Identities = 27/73 (36%), Positives = 36/73 (49%) Frame = +1 Query: 523 QTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRN 702 +TGSGKT A+ LP + + + P AL+L PTRELA QI + G V+ Sbjct: 9 ETGSGKTGAFALPILQALLDNP-----QRLFALILTPTRELAFQISEQCEALGSGIGVKC 63 Query: 703 TCVFGGAPKREQA 741 + GG QA Sbjct: 64 AVIVGGIDMMSQA 76 >SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 697 Score = 41.1 bits (92), Expect = 0.001 Identities = 31/88 (35%), Positives = 46/88 (52%), Gaps = 16/88 (18%) Frame = +1 Query: 523 QTGSGKTLAYILPAIVHIN-------NQPPI-------RRGDGPIALVLAPTRELAQQIQ 660 +TGSGKTLA+ +P I HI Q P +G +AL++APTRELA Q++ Sbjct: 176 ETGSGKTLAFGIPIIQHIEAYKKRKAEQSPSDKESDLESQGYPLLALIMAPTRELALQVK 235 Query: 661 QVAADFGHTSYVRNTCVFGG--APKREQ 738 + V+ + GG APK+++ Sbjct: 236 DHLVKAAKYTSVKVAAIVGGMAAPKQQR 263 >SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) Length = 120 Score = 38.3 bits (85), Expect = 0.007 Identities = 22/48 (45%), Positives = 26/48 (54%) Frame = +1 Query: 610 PIALVLAPTRELAQQIQQVAADFGHTSYVRNTCVFGGAPKREQARDLE 753 P ALVL+PTRELA QIQ+V G V+ GG E R L+ Sbjct: 4 PQALVLSPTRELANQIQKVVLALGDYMSVQCHACIGGTNIGEDIRKLD 51 >SB_17563| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 38.3 bits (85), Expect = 0.007 Identities = 21/55 (38%), Positives = 30/55 (54%) Frame = +1 Query: 517 RTQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG 681 R + G+GKT AY++P + + + ALVL PTRELA Q Q+ + G Sbjct: 90 RAKNGTGKTAAYLVPLLERTDTTKNCIQ-----ALVLVPTRELALQTSQICIELG 139 Score = 31.1 bits (67), Expect = 1.0 Identities = 13/41 (31%), Positives = 25/41 (60%) Frame = +3 Query: 396 FEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKN*LA 518 FE+ + G+ G+ +P+PIQ + P+A++G++ LA Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILA 89 >SB_2247| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 38.3 bits (85), Expect = 0.007 Identities = 21/55 (38%), Positives = 30/55 (54%) Frame = +1 Query: 517 RTQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG 681 R + G+GKT AY++P + + + ALVL PTRELA Q Q+ + G Sbjct: 90 RAKNGTGKTAAYLVPLLERTDTTKNCIQ-----ALVLVPTRELALQTSQICIELG 139 Score = 31.1 bits (67), Expect = 1.0 Identities = 13/41 (31%), Positives = 25/41 (60%) Frame = +3 Query: 396 FEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKN*LA 518 FE+ + G+ G+ +P+PIQ + P+A++G++ LA Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILA 89 >SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) Length = 490 Score = 37.1 bits (82), Expect = 0.015 Identities = 25/80 (31%), Positives = 44/80 (55%), Gaps = 3/80 (3%) Frame = +1 Query: 517 RTQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG-HTSY 693 ++Q+G+GKT A++L + ++ P P + L+PT ELA+Q +VA G H + Sbjct: 148 QSQSGTGKTAAFVLTMLSRVDATKPY-----PQVICLSPTYELARQTGKVAEAMGKHCPH 202 Query: 694 VR-NTCVFGGA-PKREQARD 747 ++ N V G P+ ++ D Sbjct: 203 IKINYAVRGNQFPRGQKCTD 222 >SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) Length = 559 Score = 35.5 bits (78), Expect = 0.047 Identities = 24/61 (39%), Positives = 38/61 (62%), Gaps = 1/61 (1%) Frame = +1 Query: 517 RTQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELA-QQIQQVAADFGHTSY 693 +++TG+GK+L ++LP++ Q P RG G I ++ PTRELA Q + +V+ G S Sbjct: 203 KSETGTGKSLVFLLPSV-----QDP-GRGYGTI--IVVPTRELASQMLYEVSRLLGDKSI 254 Query: 694 V 696 V Sbjct: 255 V 255 >SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) Length = 456 Score = 33.5 bits (73), Expect = 0.19 Identities = 21/74 (28%), Positives = 34/74 (45%), Gaps = 4/74 (5%) Frame = +1 Query: 529 GSGKTLAYILPAIVHINNQPPIRR---GDGPIALVLAPTRELAQQIQQVAAD-FGHTSYV 696 GSGK LAY+LP I I + +GP+ L+L + ++ V D + Sbjct: 234 GSGKRLAYLLPIIHQITESSVYQELPLANGPLVLILCTNWQNTARVYGVCEDLIRNRRRT 293 Query: 697 RNTCVFGGAPKREQ 738 R +FGG + ++ Sbjct: 294 RVQMIFGGGAEEDR 307 >SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) Length = 96 Score = 33.1 bits (72), Expect = 0.25 Identities = 18/43 (41%), Positives = 26/43 (60%) Frame = +1 Query: 526 TGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQ 654 TG+GKT A++LP + + +P + LV+ PTRELA Q Sbjct: 56 TGTGKTAAFMLPILERLLYRP--TQSPAIRVLVITPTRELAIQ 96 Score = 31.1 bits (67), Expect = 1.0 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +3 Query: 429 QGVKTMGYKEPTPIQAQGWPIAMSGKN 509 + V +G+ PTPIQA P+A+ GK+ Sbjct: 23 RAVNELGFLHPTPIQASTIPVALMGKD 49 >SB_26138| Best HMM Match : RhoGEF (HMM E-Value=0.0011) Length = 1199 Score = 31.5 bits (68), Expect = 0.76 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = +1 Query: 226 QNMRRPDWDSFHSNLSTKTFMIHILQFSKD 315 +N RR WDSFHSN+S + H+ F D Sbjct: 768 RNKRR--WDSFHSNVSADSGSAHMFDFDTD 795 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +3 Query: 387 IQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKN*LA 518 I FE+ + + + V GYK+PTP+Q PI ++ +A Sbjct: 874 ILQFEDVDLGEILLHNVGLAGYKKPTPVQKYAIPIVKGKRDLMA 917 Score = 27.9 bits (59), Expect = 9.4 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +1 Query: 523 QTGSGKTLAYILPAIVHINNQPP 591 QTGSGKT A+++P + I + P Sbjct: 920 QTGSGKTAAFLIPILSRIYMEGP 942 >SB_50950| Best HMM Match : AAA_5 (HMM E-Value=0.0006) Length = 1552 Score = 29.1 bits (62), Expect = 4.1 Identities = 17/39 (43%), Positives = 20/39 (51%) Frame = +1 Query: 424 CNKV*RQWVTKNRRLFKLKAGR*LCLERISWRTQTGSGK 540 CN+ R V K+RRL AGR L I T +GS K Sbjct: 59 CNESGRMSVDKDRRLISTSAGRVTKLPPIGAPTSSGSNK 97 >SB_19342| Best HMM Match : Keratin_B2 (HMM E-Value=0.41) Length = 1093 Score = 29.1 bits (62), Expect = 4.1 Identities = 21/79 (26%), Positives = 38/79 (48%) Frame = +1 Query: 508 ISWRTQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHT 687 IS TQT +L +P +HIN+ P R PI + + PT+ + I ++ D + Sbjct: 426 ISVDTQTTKPASLRVNVPLSLHINDSSPTRL-SFPITMDVHPTKTTSVTI-PISEDMQTS 483 Query: 688 SYVRNTCVFGGAPKREQAR 744 + + T F + +E ++ Sbjct: 484 TIAKQTSSFPRSNDKEASK 502 >SB_32980| Best HMM Match : DEAD (HMM E-Value=0) Length = 985 Score = 28.7 bits (61), Expect = 5.4 Identities = 20/80 (25%), Positives = 38/80 (47%), Gaps = 1/80 (1%) Frame = +1 Query: 517 RTQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG-HTSY 693 + ++G+GKT + + A+ ++ I + ++L PTRE+A Q++ V G H Sbjct: 56 QAKSGTGKTCVFSVIALENV-----ITESNCIQIIILTPTREIAVQVKDVICAIGCHYDG 110 Query: 694 VRNTCVFGGAPKREQARDLE 753 + GG E + L+ Sbjct: 111 LACKVFIGGISLEEDKKALK 130 >SB_19782| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 728 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = -1 Query: 232 CSDLQRILFSHQILQILQIYCHRC-QIETN 146 CS +L +IL+ +YC +C Q ETN Sbjct: 14 CSLCSEVLTEPKILRCFHVYCQKCLQAETN 43 >SB_8125| Best HMM Match : MFS_1 (HMM E-Value=3.2e-07) Length = 401 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = -1 Query: 163 CQIETNYRRICCLLQIWN-HRFHGYYSS 83 C + +YRR CC L +W H + Y+SS Sbjct: 218 CCVRVDYRRKCC-LHVWRVHTTNTYWSS 244 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,669,148 Number of Sequences: 59808 Number of extensions: 470083 Number of successful extensions: 1257 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 1172 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1242 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2046258890 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -