BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021041 (756 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC4G3.10c |rhp42|rhp4b|DNA repair protein Rhp42|Schizosaccharo... 27 2.2 SPCC338.17c |rad21||kleisin|Schizosaccharomyces pombe|chr 3|||Ma... 25 8.8 >SPCC4G3.10c |rhp42|rhp4b|DNA repair protein Rhp42|Schizosaccharomyces pombe|chr 3|||Manual Length = 686 Score = 27.5 bits (58), Expect = 2.2 Identities = 12/44 (27%), Positives = 23/44 (52%) Frame = +2 Query: 227 VRPEHRHLQDLGRKYGLAGANDEEAFEIDQNVEFLNDIRASAAS 358 V HR + +K L+ + + + +D N+ LN ++ SA+S Sbjct: 36 VSSTHRQTRSQSKKPSLSSSAEPPSESLDDNISALNSLQRSASS 79 >SPCC338.17c |rad21||kleisin|Schizosaccharomyces pombe|chr 3|||Manual Length = 628 Score = 25.4 bits (53), Expect = 8.8 Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = +3 Query: 501 ATFVRRHVRLPEGDAPEAGS--GAEVPGLQEA 590 AT + V PEG+APE GS G V L+ A Sbjct: 488 ATLPQETVVQPEGEAPELGSPMGFPVTALESA 519 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,482,455 Number of Sequences: 5004 Number of extensions: 41247 Number of successful extensions: 125 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 125 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 125 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 361294920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -