BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021041 (756 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11982| Best HMM Match : GST_N (HMM E-Value=7.9e-15) 66 4e-11 SB_19919| Best HMM Match : GST_N (HMM E-Value=4.7e-22) 66 4e-11 SB_37695| Best HMM Match : GST_N (HMM E-Value=2.4e-24) 58 6e-09 SB_28555| Best HMM Match : GST_N (HMM E-Value=3.5e-18) 52 5e-07 SB_42146| Best HMM Match : GYF (HMM E-Value=5.7e-15) 33 0.19 SB_54755| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.76 SB_20177| Best HMM Match : hATC (HMM E-Value=1e-04) 29 3.1 SB_27853| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_25424| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 >SB_11982| Best HMM Match : GST_N (HMM E-Value=7.9e-15) Length = 221 Score = 65.7 bits (153), Expect = 4e-11 Identities = 33/71 (46%), Positives = 41/71 (57%), Gaps = 2/71 (2%) Frame = +3 Query: 48 MPNVKFYYFPVKALGESQRLLLAYGGQEFEDNRISSENWPEFKP--KTPFGQMPVLEIDG 221 MPN K YF + E RL A GG +ED R++ E W + K KT G +PVLE+DG Sbjct: 1 MPNYKLIYFNTRGRAEPTRLCFAAGGIPYEDVRLTGEEWTKMKAENKTIMGYLPVLEVDG 60 Query: 222 KQYAQSTAICR 254 QY +S AI R Sbjct: 61 IQYCESMAIFR 71 >SB_19919| Best HMM Match : GST_N (HMM E-Value=4.7e-22) Length = 79 Score = 65.7 bits (153), Expect = 4e-11 Identities = 34/70 (48%), Positives = 44/70 (62%), Gaps = 3/70 (4%) Frame = +3 Query: 48 MPNVKFYYFPVKALGESQRLLLAYGGQEFEDNRISSENWPEFKPK--TPFGQMPVLEIDG 221 MP+ K YYF + E RL+ A G EFEDNR++ WP+ K + PFGQ+P+L ID Sbjct: 1 MPSYKLYYFNARGRAEPARLVFAAAGIEFEDNRMAMGEWPKVKKELHAPFGQVPLLVIDD 60 Query: 222 K-QYAQSTAI 248 K + AQS AI Sbjct: 61 KIKLAQSLAI 70 >SB_37695| Best HMM Match : GST_N (HMM E-Value=2.4e-24) Length = 102 Score = 58.4 bits (135), Expect = 6e-09 Identities = 37/81 (45%), Positives = 45/81 (55%), Gaps = 4/81 (4%) Frame = +3 Query: 18 NYSLLHNNPTMPNVKFYYFPVKALGESQRLLLAYGGQEFEDNRISS-ENWPEFKPK--TP 188 N SLL P MP+ K +YF + E RL A G E+ED R E W KP+ P Sbjct: 14 NISLLPF-PKMPSYKLHYFNARGRAEPARLAFAAAGIEYEDKRFEGREEWLRVKPELDPP 72 Query: 189 FGQMPVLEIDGK-QYAQSTAI 248 FGQ+P+L ID K + AQS AI Sbjct: 73 FGQVPLLVIDDKIKLAQSMAI 93 >SB_28555| Best HMM Match : GST_N (HMM E-Value=3.5e-18) Length = 195 Score = 52.0 bits (119), Expect = 5e-07 Identities = 28/71 (39%), Positives = 40/71 (56%), Gaps = 3/71 (4%) Frame = +3 Query: 51 PNVKFYYFPVKALGESQRLLLAYGGQEFEDNRISSENWPEFKP--KTPFGQMPVLEI-DG 221 P + YF +A E R+LL F D R++ +W K + PFG++P+LEI DG Sbjct: 3 PTYRVVYFDARARAECIRVLLHLADVPFTDERVAPPDWAAMKTSGRCPFGELPLLEISDG 62 Query: 222 KQYAQSTAICR 254 ++ AQS AI R Sbjct: 63 RKLAQSHAIFR 73 >SB_42146| Best HMM Match : GYF (HMM E-Value=5.7e-15) Length = 924 Score = 33.5 bits (73), Expect = 0.19 Identities = 21/65 (32%), Positives = 29/65 (44%) Frame = +3 Query: 93 ESQRLLLAYGGQEFEDNRISSENWPEFKPKTPFGQMPVLEIDGKQYAQSTAICRTSVAST 272 E QRL+L +E + NR ++ W E P P +LEI +Q Q A + S Sbjct: 768 ERQRLILEQQERE-QQNRAAAAGWGEHAPVGPPPVKSLLEIQEEQARQQKAKAQNQQLSR 826 Query: 273 DSPGP 287 P P Sbjct: 827 SQPAP 831 >SB_54755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 31.5 bits (68), Expect = 0.76 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +3 Query: 69 YFPVKALGESQRLLLAYGGQEFEDNRISSENWPEFK 176 YF V+A GE R+LL F + R E+WP K Sbjct: 95 YFDVRARGECIRVLLHLADVPFTEERHGLEDWPAVK 130 >SB_20177| Best HMM Match : hATC (HMM E-Value=1e-04) Length = 618 Score = 29.5 bits (63), Expect = 3.1 Identities = 19/59 (32%), Positives = 28/59 (47%) Frame = +1 Query: 451 DTDEEQRSYRAWQVDLGRLLYAGMYDYLKAMLQKPDLEQKYPAFRKPIEAVLAIPKVKA 627 D D +A VD GRL ++ YL ++ PD + ++P K + VL IP A Sbjct: 496 DGDLPSAVRQASLVDGGRLRPDAVWGYLNGLVS-PDGQPRFPRLSKVAQLVLTIPHSNA 553 >SB_27853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 642 Score = 29.1 bits (62), Expect = 4.1 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = +1 Query: 490 VDLGRLLYAGMYDYLKAMLQKPDLEQKYPAFRKPIEAVLAIPKVKA 627 VD GRL ++ YL ++ PD + ++P K + VL IP A Sbjct: 533 VDGGRLRPDAVWGYLNGLVS-PDGQPRFPRLSKVTQLVLTIPHSNA 577 >SB_25424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/42 (28%), Positives = 20/42 (47%) Frame = +3 Query: 57 VKFYYFPVKALGESQRLLLAYGGQEFEDNRISSENWPEFKPK 182 V +YF + E RL++ G + + + E+WP K K Sbjct: 54 VTLHYFGSRGKAEGIRLMMEDNGVLYAETNYTKEDWPTVKQK 95 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,048,356 Number of Sequences: 59808 Number of extensions: 313034 Number of successful extensions: 878 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 819 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 875 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2058295707 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -