BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021041 (756 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 23 4.1 X72575-1|CAA51167.1| 168|Apis mellifera Apidaecin precursor pro... 22 5.4 M29491-1|AAA27726.1| 79|Apis mellifera protein ( Bee homeobox-... 22 7.1 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 21 9.4 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 22.6 bits (46), Expect = 4.1 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +3 Query: 18 NYSLLHNNPTMPNVKFYYFPVKALGESQRLLLA 116 ++ L HN+ PN+ YY AL +L A Sbjct: 302 HWQLPHNSTNPPNILLYYRDSLALSVFALILTA 334 >X72575-1|CAA51167.1| 168|Apis mellifera Apidaecin precursor protein. Length = 168 Score = 22.2 bits (45), Expect = 5.4 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 74 PRQGPRREPEAAAGLRRP 127 P RREPEA G RP Sbjct: 112 PHPRLRREPEAEPGNNRP 129 Score = 22.2 bits (45), Expect = 5.4 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 74 PRQGPRREPEAAAGLRRP 127 P RREPEA G RP Sbjct: 138 PHPRLRREPEAEPGNNRP 155 >M29491-1|AAA27726.1| 79|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H17. ). Length = 79 Score = 21.8 bits (44), Expect = 7.1 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +3 Query: 165 PEFKPKTPFGQMPVLEIDGK 224 P KP+TPF +L ++ K Sbjct: 8 PNRKPRTPFTTQQLLSLEKK 27 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 21.4 bits (43), Expect = 9.4 Identities = 14/45 (31%), Positives = 19/45 (42%) Frame = +1 Query: 67 TISPSRPSARARGCCWLTAARSSKTIAFHLKTGQNSNLRLRSVRC 201 T S R + AR CW + ++ L T Q +LR RC Sbjct: 203 TDSDRRKGSIAR--CWSLDSTAASDEDISLTTHQQKRHKLRVTRC 245 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,460 Number of Sequences: 438 Number of extensions: 3130 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23753925 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -