BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021040 (720 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 26 0.41 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 23 2.9 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 8.9 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 8.9 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 25.8 bits (54), Expect = 0.41 Identities = 18/51 (35%), Positives = 21/51 (41%) Frame = +1 Query: 109 VTQGPPPMAATSSQSTAPRSGVTQGPPPMAAPSSQVEKCPGAPRGSQAIPP 261 +TQ P+ SQ P SG GP P S Q + P SQ PP Sbjct: 1 MTQQKQPIITQQSQQ--PSSGAP-GPQPSPHQSPQAPQRGSPPNPSQGPPP 48 Score = 22.6 bits (46), Expect = 3.8 Identities = 15/41 (36%), Positives = 19/41 (46%), Gaps = 4/41 (9%) Frame = +1 Query: 118 GPPPMAATSSQSTAPRSGV----TQGPPPMAAPSSQVEKCP 228 GP P S Q AP+ G +QGPPP P + + P Sbjct: 22 GPQPSPHQSPQ--APQRGSPPNPSQGPPPGGPPGAPPSQNP 60 Score = 22.2 bits (45), Expect = 5.1 Identities = 11/31 (35%), Positives = 13/31 (41%) Frame = +1 Query: 88 SAAPRLGVTQGPPPMAATSSQSTAPRSGVTQ 180 S P G G PP S +P SG+ Q Sbjct: 43 SQGPPPGGPPGAPPSQNPSQMMISPASGIHQ 73 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 23.0 bits (47), Expect = 2.9 Identities = 10/45 (22%), Positives = 21/45 (46%) Frame = +1 Query: 37 NEAVSGSTSQDAQQRAVSAAPRLGVTQGPPPMAATSSQSTAPRSG 171 +E V + S + +++AP + PP A ++ + R+G Sbjct: 501 HEPVVETNSSPSPNPRIASAPSSSTSSSPPAKGAAAAGQPSKRNG 545 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.4 bits (43), Expect = 8.9 Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 4/38 (10%) Frame = +1 Query: 64 QDAQQRAVSAAPRLGVTQGPPPM----AATSSQSTAPR 165 Q QQ++ S +G + P AATSS ST+PR Sbjct: 806 QQQQQQSSSDYLMVGNSPASSPRYLSAAATSSTSTSPR 843 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.4 bits (43), Expect = 8.9 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +3 Query: 600 KSIFAPRKNKPDSKQSS 650 K P KN PDSK+ S Sbjct: 191 KDNLIPDKNDPDSKECS 207 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.311 0.124 0.371 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,239 Number of Sequences: 438 Number of extensions: 4436 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22292145 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits)
- SilkBase 1999-2023 -