BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021039 (758 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0313 + 14233049-14234362,14234558-14235523 29 4.0 10_08_0253 - 16196275-16196307,16196425-16196550,16196643-161967... 28 9.3 06_01_1090 - 8945909-8946125,8946607-8947562,8947733-8949835 28 9.3 >04_03_0313 + 14233049-14234362,14234558-14235523 Length = 759 Score = 29.1 bits (62), Expect = 4.0 Identities = 16/36 (44%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = +1 Query: 505 NMKLCIAYFNQFNKMKNILSLFLLGCPLIMM-ESLG 609 N+K+ I +FNQ + NIL + L GC L+ + ES+G Sbjct: 549 NLKVEITWFNQ---LSNILFMSLQGCKLVKLPESIG 581 >10_08_0253 - 16196275-16196307,16196425-16196550,16196643-16196741, 16196822-16197001,16197090-16197371,16197471-16199141, 16199257-16199463,16199566-16199700,16199792-16200082, 16200403-16200621,16200876-16201034,16201120-16201181, 16201257-16201383,16201460-16201693,16201777-16202003, 16202163-16202257,16202341-16202468,16202574-16202594, 16202765-16202921,16203007-16203075,16203228-16203341, 16203415-16203491,16203576-16203688,16204432-16204507, 16204592-16204756,16204825-16204952,16205049-16205130, 16205426-16205548,16205633-16205860,16205933-16206034, 16206144-16206341,16206581-16206760,16206868-16207020, 16207690-16207797,16208201-16208355,16208786-16208912, 16209825-16209914,16209986-16210127,16210303-16210379, 16210467-16210582,16210638-16210773,16211130-16211198, 16211279-16211361,16211655-16211720,16211788-16211974, 16212054-16213547,16213635-16214165,16214234-16214363, 16214407-16215878,16216359-16216364,16216750-16217055, 16217364-16217468,16217577-16217772,16217862-16217929, 16218853-16220631,16221026-16221151,16221604-16221780, 16221997-16222128,16223461-16223498,16223710-16223788, 16224175-16224284,16224787-16224935,16225027-16225197, 16225281-16225552,16226355-16226442,16227942-16228369 Length = 5157 Score = 27.9 bits (59), Expect = 9.3 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = +1 Query: 472 VIVDARIQEKKNMKLCIAYFNQFNKMKNILSLFLLGCPLIMMESL 606 +I D + EK+N+K C+ N N+ + I + L G +M+SL Sbjct: 5063 IISDGKFHEKENLKRCVR--NVLNRKRMIAYVLLDGHEESIMDSL 5105 >06_01_1090 - 8945909-8946125,8946607-8947562,8947733-8949835 Length = 1091 Score = 27.9 bits (59), Expect = 9.3 Identities = 13/25 (52%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Frame = +1 Query: 538 FNKMKNILSLFLLGCPLIMM-ESLG 609 FN++ NIL L L GC L+ + ES+G Sbjct: 620 FNQLSNILYLSLKGCKLVKLPESIG 644 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,382,203 Number of Sequences: 37544 Number of extensions: 392811 Number of successful extensions: 954 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 922 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 954 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2027850416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -