BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021035 (812 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix... 23 2.9 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 22 5.0 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 22 5.0 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 5.0 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 5.0 AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 22 6.7 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 22 6.7 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 22 6.7 AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain tran... 22 6.7 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 22 6.7 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 22 6.7 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 22 6.7 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 22 6.7 AF264695-1|AAG13009.1| 100|Tribolium castaneum cephalothorax pr... 22 6.7 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 22 6.7 AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia or... 22 6.7 AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 21 8.8 >AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix transcription factor protein. Length = 249 Score = 23.0 bits (47), Expect = 2.9 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = +2 Query: 674 RPTSTKLSICVEYPTSLPWRDW 739 RP S + C E PWR W Sbjct: 228 RPLSLVVRRCEEPTEEKPWRPW 249 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 22.2 bits (45), Expect = 5.0 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +1 Query: 319 KKNTDAMRSFSFPFIALQDVTVEQPMFSANCIKGKVR 429 + D ++ F P + +QDVT++ FS ++ K R Sbjct: 649 RNGVDTLQQFLTPNMRVQDVTIK---FSDRTVRPKQR 682 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 22.2 bits (45), Expect = 5.0 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 564 AKHQLPYDEKQDEQLLTWL 508 AKH + YD+ +D L T L Sbjct: 569 AKHYVQYDQGEDRWLCTLL 587 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 22.2 bits (45), Expect = 5.0 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 564 AKHQLPYDEKQDEQLLTWL 508 AKH + YD+ +D L T L Sbjct: 802 AKHYVQYDQGEDRWLCTLL 820 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 22.2 bits (45), Expect = 5.0 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 564 AKHQLPYDEKQDEQLLTWL 508 AKH + YD+ +D L T L Sbjct: 802 AKHYVQYDQGEDRWLCTLL 820 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 21.8 bits (44), Expect = 6.7 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = -1 Query: 797 LEPTNPTTPGKPRAGRIRSSSHA 729 + PT P TP P R+ S A Sbjct: 93 VSPTTPPTPSPPPEERLTPSKDA 115 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 6.7 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = -3 Query: 438 RLGTNFTFYTVGREHRLFHSYILQCNKRKTE*SHGICI 325 R T++T Y + FH +R+ E +H +C+ Sbjct: 222 RQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCL 259 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 6.7 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = -3 Query: 438 RLGTNFTFYTVGREHRLFHSYILQCNKRKTE*SHGICI 325 R T++T Y + FH +R+ E +H +C+ Sbjct: 222 RQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCL 259 >AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain transcription factor Maxillopediaprotein. Length = 523 Score = 21.8 bits (44), Expect = 6.7 Identities = 11/33 (33%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = -3 Query: 801 LPGTHKPHHPRKTQGRSDKKLQ--SRQGREVGY 709 LP TH H P +++ LQ + +VGY Sbjct: 405 LPNTHMGHEPGAAYYQNENMLQKNAEYSGKVGY 437 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 6.7 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = -3 Query: 438 RLGTNFTFYTVGREHRLFHSYILQCNKRKTE*SHGICI 325 R T++T Y + FH +R+ E +H +C+ Sbjct: 222 RQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCL 259 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 21.8 bits (44), Expect = 6.7 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = -3 Query: 438 RLGTNFTFYTVGREHRLFHSYILQCNKRKTE*SHGICI 325 R T++T Y + FH +R+ E +H +C+ Sbjct: 222 RQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCL 259 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 21.8 bits (44), Expect = 6.7 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = -3 Query: 438 RLGTNFTFYTVGREHRLFHSYILQCNKRKTE*SHGICI 325 R T++T Y + FH +R+ E +H +C+ Sbjct: 178 RQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCL 215 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 21.8 bits (44), Expect = 6.7 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = -3 Query: 438 RLGTNFTFYTVGREHRLFHSYILQCNKRKTE*SHGICI 325 R T++T Y + FH +R+ E +H +C+ Sbjct: 222 RQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCL 259 >AF264695-1|AAG13009.1| 100|Tribolium castaneum cephalothorax protein. Length = 100 Score = 21.8 bits (44), Expect = 6.7 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = -3 Query: 438 RLGTNFTFYTVGREHRLFHSYILQCNKRKTE*SHGICI 325 R T++T Y + FH +R+ E +H +C+ Sbjct: 10 RQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCL 47 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 21.8 bits (44), Expect = 6.7 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = -3 Query: 438 RLGTNFTFYTVGREHRLFHSYILQCNKRKTE*SHGICI 325 R T++T Y + FH +R+ E +H +C+ Sbjct: 222 RQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCL 259 >AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia ortholog protein. Length = 471 Score = 21.8 bits (44), Expect = 6.7 Identities = 11/33 (33%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = -3 Query: 801 LPGTHKPHHPRKTQGRSDKKLQ--SRQGREVGY 709 LP TH H P +++ LQ + +VGY Sbjct: 353 LPNTHMGHEPGAAYYQNENMLQKNAEYSGKVGY 385 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 21.4 bits (43), Expect = 8.8 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = -1 Query: 812 RRSPFLEPTNPTTPGKP 762 R P+ P PT GKP Sbjct: 134 REKPYTPPRLPTVYGKP 150 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,971 Number of Sequences: 336 Number of extensions: 4085 Number of successful extensions: 29 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22206566 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -