BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021035 (812 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g11680.1 68418.m01365 expressed protein predicted proteins, A... 40 0.001 At3g10300.3 68416.m01236 calcium-binding EF hand family protein ... 33 0.30 At3g10300.2 68416.m01235 calcium-binding EF hand family protein ... 33 0.30 At3g10300.1 68416.m01234 calcium-binding EF hand family protein ... 33 0.30 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 32 0.39 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 31 0.69 At4g18570.1 68417.m02749 proline-rich family protein common fami... 30 2.1 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 30 2.1 At1g26250.1 68414.m03202 proline-rich extensin, putative similar... 30 2.1 At1g26240.1 68414.m03201 proline-rich extensin-like family prote... 30 2.1 At5g04920.1 68418.m00519 vacuolar protein sorting 36 family prot... 29 2.8 At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 29 2.8 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 29 3.7 At4g08370.1 68417.m01382 proline-rich extensin-like family prote... 29 4.9 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 29 4.9 At1g74530.2 68414.m08635 expressed protein 29 4.9 At1g74530.1 68414.m08634 expressed protein 29 4.9 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 28 6.4 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 28 6.4 At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family... 28 6.4 At1g61080.1 68414.m06877 proline-rich family protein 28 6.4 At3g20850.1 68416.m02636 proline-rich family protein contains pr... 28 8.5 At3g01560.1 68416.m00086 proline-rich family protein contains pr... 28 8.5 At2g47480.1 68415.m05926 expressed protein 28 8.5 >At5g11680.1 68418.m01365 expressed protein predicted proteins, Arabidopsis thaliana Length = 207 Score = 40.3 bits (90), Expect = 0.001 Identities = 24/77 (31%), Positives = 35/77 (45%), Gaps = 4/77 (5%) Frame = +1 Query: 274 EGRMYLTTHRMIYNSKKNTDAMRSFSFPFIALQDVTVEQPMFSANCIKGKVRAQPNGN-- 447 +G +YL+ RM++ S K D +F P + + QP+F N I G+V N Sbjct: 46 KGVIYLSNIRMVFVSSKPVDNFVAFDMPLLYIHAEKFNQPIFHCNNIAGQVEPVVPENEH 105 Query: 448 --FIGEVKFKLTFKSGG 492 FK+ FK GG Sbjct: 106 RALYSTHSFKILFKEGG 122 >At3g10300.3 68416.m01236 calcium-binding EF hand family protein low similarity to SP|P12815 Programmed cell death protein 6 (Probable calcium-binding protein ALG-2) {Mus musculus}; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 335 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPYPGVTGASY 749 PPY + + PPP SN PPPY + Y Sbjct: 22 PPYGSTGNNPPPYGSSGSNPPPPYGSSASSPY 53 >At3g10300.2 68416.m01235 calcium-binding EF hand family protein low similarity to SP|P12815 Programmed cell death protein 6 (Probable calcium-binding protein ALG-2) {Mus musculus}; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 324 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPYPGVTGASY 749 PPY + + PPP SN PPPY + Y Sbjct: 22 PPYGSTGNNPPPYGSSGSNPPPPYGSSASSPY 53 >At3g10300.1 68416.m01234 calcium-binding EF hand family protein low similarity to SP|P12815 Programmed cell death protein 6 (Probable calcium-binding protein ALG-2) {Mus musculus}; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 232 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPYPGVTGASY 749 PPY + + PPP SN PPPY + Y Sbjct: 22 PPYGSTGNNPPPYGSSGSNPPPPYGSSASSPY 53 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 32.3 bits (70), Expect = 0.39 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPYPGVT 737 PPY + PPP + + + +PPP P T Sbjct: 598 PPYYQYTSSPPPPTYYATQSPPPPPPPT 625 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPYP 728 PP S P PPP ++ S+ PPP P Sbjct: 531 PPLSPPPPSPPPPYIY-SSPPPPSP 554 >At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibitor family protein low similarity to extensin [Volvox carteri] GI:21992 Length = 312 Score = 31.5 bits (68), Expect = 0.69 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPYP 728 PP S P PPP S+ S+ PPP P Sbjct: 49 PPSSLSPSSPPPLSLSPSSPPPPPP 73 Score = 31.5 bits (68), Expect = 0.69 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPYP 728 PP S P PPP S+ S+ PPP P Sbjct: 98 PPSSLSPSSPPPLSLSPSSPPPPPP 122 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 29.9 bits (64), Expect = 2.1 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPYPGVTGASYP 752 PP + P PPP + PPP P V+ A P Sbjct: 304 PPQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPP 336 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPYPGVTGASYP 752 P +A P PPP + PPP PG GA P Sbjct: 390 PSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPP 422 >At1g26250.1 68414.m03202 proline-rich extensin, putative similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 443 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 313 PPY-VYKSPPPPPYVYTSPPPPPY 335 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 93 PPY-VYSSPPPPPYVYKSPPPPPY 115 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 103 PPY-VYKSPPPPPYVYSSPPPPPY 125 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 113 PPY-VYSSPPPPPYVYKSPPPPPY 135 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 123 PPY-VYKSPPPPPYVYSSPPPPPY 145 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 133 PPY-VYSSPPPPPYVYSSPPPPPY 155 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 143 PPY-VYSSPPPPPYVYKSPPPPPY 165 Score = 29.1 bits (62), Expect = 3.7 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY P PPP V+ S PPPY Sbjct: 163 PPYVYSPPPPPPY-VYQSPPPPPY 185 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 173 PPY-VYQSPPPPPYVYSSPPPPPY 195 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 183 PPY-VYSSPPPPPYVYKSPPPPPY 205 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 193 PPY-VYKSPPPPPYVYSSPPPPPY 215 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 203 PPY-VYSSPPPPPYVYKSPPPPPY 225 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 213 PPY-VYKSPPPPPYVYSSPPPPPY 235 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 223 PPY-VYSSPPPPPYVYKSPPPPPY 245 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 233 PPY-VYKSPPPPPYVYSSPPPPPY 255 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 243 PPY-VYSSPPPPPYVYKSPPPPPY 265 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 253 PPY-VYKSPPPPPYVYSSPPPPPY 275 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 263 PPY-VYSSPPPPPYVYKSPPPPPY 285 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 273 PPY-VYKSPPPPPYVYSSPPPPPY 295 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 283 PPY-VYSSPPPPPYVYSSPPPPPY 305 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 293 PPY-VYSSPPPPPYVYSSPPPPPY 315 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 303 PPY-VYSSPPPPPYVYKSPPPPPY 325 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 323 PPY-VYTSPPPPPYVYKSPPPPPY 345 Score = 28.7 bits (61), Expect = 4.9 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 63 PPY-IYSSPPPPPYVYSSPPPPPY 85 Score = 28.7 bits (61), Expect = 4.9 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 73 PPY-VYSSPPPPPYVYNSPPPPPY 95 Score = 28.7 bits (61), Expect = 4.9 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 83 PPY-VYNSPPPPPYVYSSPPPPPY 105 >At1g26240.1 68414.m03201 proline-rich extensin-like family protein similar to hydroxyproline-rich glycoprotein precursor gi|727264|gb|AAA87902; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 478 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S +PPPY Sbjct: 433 PPY-VYSSPPPPPYVYKSPSPPPY 455 Score = 29.1 bits (62), Expect = 3.7 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PP + PPP V+ S PPPY Sbjct: 42 PPTHIYSSPPPPPYVYSSPPPPPY 65 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 113 PPY-VYSSPPPPPYVYKSPPPPPY 135 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 143 PPY-VYKSPPPPPYVYSSPPPPPY 165 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 153 PPY-VYSSPPPPPYVYKSPPPPPY 175 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 163 PPY-VYKSPPPPPYVYSSPPPPPY 185 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 173 PPY-VYSSPPPPPYVYKSPPPPPY 195 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 183 PPY-VYKSPPPPPYVYSSPPPPPY 205 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 193 PPY-VYSSPPPPPYVYKSPPPPPY 215 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 203 PPY-VYKSPPPPPYVYSSPPPPPY 225 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 213 PPY-VYSSPPPPPYVYKSPPPPPY 235 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 223 PPY-VYKSPPPPPYVYSSPPPPPY 245 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 233 PPY-VYSSPPPPPYVYKSPPPPPY 255 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 243 PPY-VYKSPPPPPYVYSSPPPPPY 265 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 253 PPY-VYSSPPPPPYVYKSPPPPPY 275 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 263 PPY-VYKSPPPPPYVYSSPPPPPY 285 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 273 PPY-VYSSPPPPPYVYKSPPPPPY 295 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 283 PPY-VYKSPPPPPYVYSSPPPPPY 305 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 293 PPY-VYSSPPPPPYVYKSPPPPPY 315 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 303 PPY-VYKSPPPPPYVYSSPPPPPY 325 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 313 PPY-VYSSPPPPPYVYKSPPPPPY 335 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 373 PPY-VYSSPPPPPYVYKSPPPPPY 395 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 383 PPY-VYKSPPPPPYVYSSPPPPPY 405 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 393 PPY-VYSSPPPPPYVYKSPPPPPY 415 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 403 PPY-VYKSPPPPPYVYSSPPPPPY 425 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 413 PPY-VYSSPPPPPYVYKSPPPPPY 435 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 423 PPY-VYKSPPPPPYVYSSPPPPPY 445 Score = 28.7 bits (61), Expect = 4.9 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP ++ S PPPY Sbjct: 53 PPY-VYSSPPPPPYIYKSPPPPPY 75 Score = 28.7 bits (61), Expect = 4.9 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 63 PPY-IYKSPPPPPYVYSSPPPPPY 85 Score = 28.7 bits (61), Expect = 4.9 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP ++ S PPPY Sbjct: 73 PPY-VYSSPPPPPYIYKSPPPPPY 95 Score = 28.7 bits (61), Expect = 4.9 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 83 PPY-IYKSPPPPPYVYSSPPPPPY 105 Score = 28.7 bits (61), Expect = 4.9 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP ++ S PPPY Sbjct: 93 PPY-VYSSPPPPPYIYKSPPPPPY 115 Score = 28.7 bits (61), Expect = 4.9 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 103 PPY-IYKSPPPPPYVYSSPPPPPY 125 Score = 28.7 bits (61), Expect = 4.9 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 123 PPY-VYKSPPPPPYVYNSPPPPPY 145 Score = 28.7 bits (61), Expect = 4.9 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 133 PPY-VYNSPPPPPYVYKSPPPPPY 155 Score = 28.7 bits (61), Expect = 4.9 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 323 PPY-VYKSPPPPPYVYNSPPPPPY 345 Score = 28.7 bits (61), Expect = 4.9 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 333 PPY-VYNSPPPPPYVYKSPPPPPY 355 >At5g04920.1 68418.m00519 vacuolar protein sorting 36 family protein / VPS36 family protein contains Pfam PF04132: Vacuolar protein sorting 36 Length = 440 Score = 29.5 bits (63), Expect = 2.8 Identities = 16/72 (22%), Positives = 37/72 (51%), Gaps = 1/72 (1%) Frame = +1 Query: 259 FKGIKEGRMYLTTHRMIYNSKKNTDAMRSFSFPFIALQDVTVEQPMFSANCIKGKVRAQP 438 F ++ G + LTTHR+I+ ++ +++ S S P A+ + + + ++R Q Sbjct: 51 FTALRSGNLILTTHRLIWIPSQSNESVPS-SIPLSAVTHIYSHKKSIKSMFHSPRIRFQA 109 Query: 439 N-GNFIGEVKFK 471 + G+ + + F+ Sbjct: 110 DPGSIVVTIVFR 121 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 29.5 bits (63), Expect = 2.8 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPYP 728 PP + PPP V+ S+ PPP P Sbjct: 642 PPPPVYYSSPPPPPVYYSSPPPPPP 666 Score = 28.7 bits (61), Expect = 4.9 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPYPGVTGASYPT 755 PP+S P PP ++ +PPP P + PT Sbjct: 571 PPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPT 604 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPYP 728 P YS P PPP V+ PPP P Sbjct: 434 PVYSPPPPPPPPPPVYSPPPPPPPP 458 Score = 27.9 bits (59), Expect = 8.5 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 3/27 (11%) Frame = +3 Query: 654 PPYSAFPDQ---PPPNSVFVSNTPPPY 725 PP+S P Q PPP + S+ PPP+ Sbjct: 541 PPHSPPPPQFSPPPPEPYYYSSPPPPH 567 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PPY + PPP V+ S PPPY Sbjct: 477 PPY-VYSSPPPPPYVYSSPPPPPY 499 >At4g08370.1 68417.m01382 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 350 Score = 28.7 bits (61), Expect = 4.9 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 PP + PPP ++ S PPPY Sbjct: 98 PPPFVYSSPPPPTYIYNSPPPPPY 121 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPYPGVTGASYP 752 PP S PPP V S+ PPP P G P Sbjct: 447 PPPSIHYSSPPPPPVHHSSPPPPSPEFEGPLPP 479 >At1g74530.2 68414.m08635 expressed protein Length = 262 Score = 28.7 bits (61), Expect = 4.9 Identities = 22/68 (32%), Positives = 33/68 (48%), Gaps = 1/68 (1%) Frame = -3 Query: 714 GYSTQILSLVEVGLEKQNKVAPIHNILVEEVHMLVVVRLATVQSVGYKEVAKHQL-PYDE 538 G ++Q LSL ++ K K+AP+ + V V+ L+T SV EV K+ PY E Sbjct: 79 GETSQSLSLSDLFTLKDGKIAPVLKVANPPVR-ANVLHLSTEYSVPVLEVVKNVFSPYFE 137 Query: 537 KQDEQLLT 514 +T Sbjct: 138 NSKPAAIT 145 >At1g74530.1 68414.m08634 expressed protein Length = 318 Score = 28.7 bits (61), Expect = 4.9 Identities = 22/68 (32%), Positives = 33/68 (48%), Gaps = 1/68 (1%) Frame = -3 Query: 714 GYSTQILSLVEVGLEKQNKVAPIHNILVEEVHMLVVVRLATVQSVGYKEVAKHQL-PYDE 538 G ++Q LSL ++ K K+AP+ + V V+ L+T SV EV K+ PY E Sbjct: 79 GETSQSLSLSDLFTLKDGKIAPVLKVANPPVR-ANVLHLSTEYSVPVLEVVKNVFSPYFE 137 Query: 537 KQDEQLLT 514 +T Sbjct: 138 NSKPAAIT 145 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 28.3 bits (60), Expect = 6.4 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPYP 728 PP+ + P QPPP+ + PPP P Sbjct: 46 PPHFSPPHQPPPSPYPHPHPPPPSP 70 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPYPGV 734 PP A PP V+ N+PPP P V Sbjct: 771 PPSPAHYSPPPSPPVYYYNSPPPPPAV 797 >At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family protein similar to SWISS-PROT:Q15428 Length = 277 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPYP 728 PP+ A P PPP+ +F PPP P Sbjct: 236 PPHQAQPPPPPPSGLF---PPPPPP 257 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 28.3 bits (60), Expect = 6.4 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +3 Query: 672 PDQPPPNSVFVSNTPPPYPGVTGASYP 752 P PPP + PPP PG A P Sbjct: 525 PPPPPPRAAVAPPPPPPPPGTAAAPPP 551 Score = 27.9 bits (59), Expect = 8.5 Identities = 14/36 (38%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = +3 Query: 654 PPYSAF---PDQPPPNSVFVSNTPPPYPGVTGASYP 752 PP +A P PPP + PPP PG A P Sbjct: 529 PPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPP 564 >At3g20850.1 68416.m02636 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 27.9 bits (59), Expect = 8.5 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPYPGVTGASYP 752 PP AFP + + +PPP P G YP Sbjct: 91 PPPVAFPPPQAYQAYYYRKSPPPPPSKYGKVYP 123 >At3g01560.1 68416.m00086 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 511 Score = 27.9 bits (59), Expect = 8.5 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +3 Query: 654 PPYSAFPDQPPPNSVFVSNTPPPY 725 P +P QPPP+S + PPY Sbjct: 320 PQQPQYPQQPPPSSGYNPEEQPPY 343 >At2g47480.1 68415.m05926 expressed protein Length = 110 Score = 27.9 bits (59), Expect = 8.5 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -1 Query: 791 PTNPTTPGKPRAGRIRSSSHARVG 720 P+ P PGK AGR +SS R+G Sbjct: 40 PSLPPPPGKVAAGRSNASSSLRIG 63 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,686,096 Number of Sequences: 28952 Number of extensions: 352229 Number of successful extensions: 1894 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 1089 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1821 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1853336000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -