BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021032 (758 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF283269-1|AAG15374.1| 114|Anopheles gambiae ribosomal protein ... 25 2.5 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 24 5.9 >AF283269-1|AAG15374.1| 114|Anopheles gambiae ribosomal protein S26 protein. Length = 114 Score = 25.0 bits (52), Expect = 2.5 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = +2 Query: 260 IWHTYIIGTLLTETHYCFTAEIGKAVVPTR 349 ++ +Y++ L + HYC + I VV R Sbjct: 57 VYSSYVLPKLYAKLHYCVSCAIHSKVVRNR 86 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 23.8 bits (49), Expect = 5.9 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +2 Query: 281 GTLLTETHYCFTAEIGKAVVPTRVDSLEVLP 373 G L H F AEIG ++V DS E+LP Sbjct: 932 GYWLFHCHIEFHAEIGMSLVLKVGDSSEMLP 962 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 681,304 Number of Sequences: 2352 Number of extensions: 13403 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78586767 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -