BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021032 (758 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY061385-1|AAL28933.1| 49|Drosophila melanogaster LD30889p pro... 31 2.3 X14247-1|CAA32463.1| 114|Drosophila melanogaster ribosomal prot... 29 6.9 X13625-1|CAB38441.1| 114|Drosophila melanogaster protein ( Dros... 29 6.9 AY069761-1|AAL39906.1| 114|Drosophila melanogaster RE01079p pro... 29 6.9 AE014134-2931|AAN11005.1| 114|Drosophila melanogaster CG10305-P... 29 6.9 AE014134-2930|AAF53666.1| 114|Drosophila melanogaster CG10305-P... 29 6.9 AE014134-2929|AAN11004.1| 114|Drosophila melanogaster CG10305-P... 29 6.9 >AY061385-1|AAL28933.1| 49|Drosophila melanogaster LD30889p protein. Length = 49 Score = 30.7 bits (66), Expect = 2.3 Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 1/25 (4%) Frame = +1 Query: 541 VVSSCYLR*TFFFFYI-SLSKHRHI 612 ++SSC L+ FFFF++ SLS H H+ Sbjct: 7 IISSCGLKFFFFFFFLNSLSNHTHM 31 >X14247-1|CAA32463.1| 114|Drosophila melanogaster ribosomal protein S31 protein. Length = 114 Score = 29.1 bits (62), Expect = 6.9 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +2 Query: 260 IWHTYIIGTLLTETHYCFTAEIGKAVVPTR 349 IW +Y++ L + HYC + I VV R Sbjct: 58 IWDSYVLPKLYAKLHYCVSCAIHSKVVRNR 87 >X13625-1|CAB38441.1| 114|Drosophila melanogaster protein ( Drosophila melanogastermRNA for putative ribosomal protein S31. ). Length = 114 Score = 29.1 bits (62), Expect = 6.9 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +2 Query: 260 IWHTYIIGTLLTETHYCFTAEIGKAVVPTR 349 IW +Y++ L + HYC + I VV R Sbjct: 58 IWDSYVLPKLYAKLHYCVSCAIHSKVVRNR 87 >AY069761-1|AAL39906.1| 114|Drosophila melanogaster RE01079p protein. Length = 114 Score = 29.1 bits (62), Expect = 6.9 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +2 Query: 260 IWHTYIIGTLLTETHYCFTAEIGKAVVPTR 349 IW +Y++ L + HYC + I VV R Sbjct: 58 IWDSYVLPKLYAKLHYCVSCAIHSKVVRNR 87 >AE014134-2931|AAN11005.1| 114|Drosophila melanogaster CG10305-PC, isoform C protein. Length = 114 Score = 29.1 bits (62), Expect = 6.9 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +2 Query: 260 IWHTYIIGTLLTETHYCFTAEIGKAVVPTR 349 IW +Y++ L + HYC + I VV R Sbjct: 58 IWDSYVLPKLYAKLHYCVSCAIHSKVVRNR 87 >AE014134-2930|AAF53666.1| 114|Drosophila melanogaster CG10305-PB, isoform B protein. Length = 114 Score = 29.1 bits (62), Expect = 6.9 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +2 Query: 260 IWHTYIIGTLLTETHYCFTAEIGKAVVPTR 349 IW +Y++ L + HYC + I VV R Sbjct: 58 IWDSYVLPKLYAKLHYCVSCAIHSKVVRNR 87 >AE014134-2929|AAN11004.1| 114|Drosophila melanogaster CG10305-PA, isoform A protein. Length = 114 Score = 29.1 bits (62), Expect = 6.9 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +2 Query: 260 IWHTYIIGTLLTETHYCFTAEIGKAVVPTR 349 IW +Y++ L + HYC + I VV R Sbjct: 58 IWDSYVLPKLYAKLHYCVSCAIHSKVVRNR 87 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,143,142 Number of Sequences: 53049 Number of extensions: 519893 Number of successful extensions: 996 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 995 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 995 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3478915869 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -