BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021032 (758 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024817-56|AAK68528.1| 166|Caenorhabditis elegans Hypothetical... 29 4.7 U97403-7|AAB52475.2| 179|Caenorhabditis elegans Hypothetical pr... 28 8.3 >AC024817-56|AAK68528.1| 166|Caenorhabditis elegans Hypothetical protein Y54G2A.3 protein. Length = 166 Score = 28.7 bits (61), Expect = 4.7 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = -3 Query: 684 PLKAIRLGREKIIRNMSPLRKLSPYVTMFTQTYIKKKKRLPQIARRYN 541 P K L + +I RN + K+SP V Q YI+K++ R+++ Sbjct: 37 PYKLEALKKAQIERNNEWIEKMSPIVKYKIQEYIRKQRAKKMQRRKFS 84 >U97403-7|AAB52475.2| 179|Caenorhabditis elegans Hypothetical protein T10E9.8 protein. Length = 179 Score = 27.9 bits (59), Expect = 8.3 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +2 Query: 503 NFNLFTSVLGC*WLYLLAIC 562 N N F SVLG W+YL AIC Sbjct: 130 NENKFYSVLGPFWMYLGAIC 149 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,942,655 Number of Sequences: 27780 Number of extensions: 283188 Number of successful extensions: 458 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 451 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 458 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1809061256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -