BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021031 (738 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein... 116 8e-28 AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. 25 3.2 AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. 25 3.2 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 4.3 AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. 24 5.6 AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. 24 5.6 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 24 5.6 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 24 5.6 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 23 7.4 AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. 23 9.8 AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. 23 9.8 AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. 23 9.8 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 23 9.8 AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein prot... 23 9.8 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 23 9.8 >AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein 70 protein. Length = 78 Score = 116 bits (279), Expect = 8e-28 Identities = 55/64 (85%), Positives = 60/64 (93%) Frame = +2 Query: 509 DSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFDVSILT 688 DSQRQATKDAG I+GLNV+RIINEPTAAA+AYGLDK GERNVLIFDLGGGTFDVSILT Sbjct: 12 DSQRQATKDAGAIAGLNVMRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILT 71 Query: 689 IEDG 700 I++G Sbjct: 72 IDEG 75 >AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 24.6 bits (51), Expect = 3.2 Identities = 8/33 (24%), Positives = 15/33 (45%) Frame = -1 Query: 735 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 637 W+ P T+ +P++ PPP + +T Sbjct: 221 WIDPTATTTTHVPTTTTTWSDLPPPPPTTTTTT 253 >AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 24.6 bits (51), Expect = 3.2 Identities = 8/33 (24%), Positives = 15/33 (45%) Frame = -1 Query: 735 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 637 W+ P T+ +P++ PPP + +T Sbjct: 222 WIDPTATTTTHVPTTTTTWSDLPPPPPTTTTTT 254 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 24.2 bits (50), Expect = 4.3 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = +3 Query: 57 NGKSTRSRNRSGYHVLLRWCLPAREGGDHR--QRPG 158 +GK RS + +++LL P REG H+ Q PG Sbjct: 1802 DGKYKRSYSYEPHNLLLSNLFPPREGFHHKAVQLPG 1837 >AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.8 bits (49), Expect = 5.6 Identities = 8/33 (24%), Positives = 14/33 (42%) Frame = -1 Query: 735 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 637 W+ P T+ P++ PPP + +T Sbjct: 222 WIDPTATTTTHAPTTTTTWSDQPPPPPTTTTTT 254 >AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.8 bits (49), Expect = 5.6 Identities = 8/33 (24%), Positives = 14/33 (42%) Frame = -1 Query: 735 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 637 W+ P T+ +P + PPP + +T Sbjct: 222 WIDPTATTTTHVPPTTTTWSDLPPPPPTTTTTT 254 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 23.8 bits (49), Expect = 5.6 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +2 Query: 443 NCRSLSRQNCAECSHHGSRVLQDSQRQATKDAG 541 +CRS + CAECS + + + ++ Q + G Sbjct: 1826 HCRSCGQIFCAECSDYTAHLPEERLYQPVRLCG 1858 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 23.8 bits (49), Expect = 5.6 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +2 Query: 443 NCRSLSRQNCAECSHHGSRVLQDSQRQATKDAG 541 +CRS + CAECS + + + ++ Q + G Sbjct: 1827 HCRSCGQIFCAECSDYTAHLPEERLYQPVRLCG 1859 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 23.4 bits (48), Expect = 7.4 Identities = 23/70 (32%), Positives = 35/70 (50%), Gaps = 14/70 (20%) Frame = -1 Query: 732 VSPAVDFTSKIPSSMVRMDTSKVPPP---RSKI---------STFRS-PVPF-LSRP*AI 595 +SP +F++ S++ ++ + PPP RSK T RS PVPF L+ P A Sbjct: 439 ISPPAEFSNGSSKSLLLLNGNGPPPPVPERSKTPNSIYLSQNGTPRSTPVPFALAPPPAA 498 Query: 594 AAAVGSLMIR 565 + A G +R Sbjct: 499 SPAFGDRSVR 508 >AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/33 (24%), Positives = 14/33 (42%) Frame = -1 Query: 735 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 637 W+ P T+ P++ PPP + +T Sbjct: 222 WIDPTATTTTHAPTTTTTWSDLPPPPPTTTTTT 254 >AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/33 (24%), Positives = 14/33 (42%) Frame = -1 Query: 735 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 637 W+ P T+ P++ PPP + +T Sbjct: 222 WIDPTATTTTHAPTTTTTWSDLPPPPPTTTTTT 254 >AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/33 (24%), Positives = 14/33 (42%) Frame = -1 Query: 735 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 637 W+ P T+ P++ PPP + +T Sbjct: 221 WIDPTATTTTHAPTTTTTWSDLPPPPPTTTTTT 253 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 23.0 bits (47), Expect = 9.8 Identities = 13/43 (30%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = -1 Query: 711 TSKIPSSMVRMDTSKVPPPRSKISTFRSPVPFLS-RP*AIAAA 586 T+K+ + M T+ PPP ++ +P P + +P + AAA Sbjct: 572 TTKLSTMMTTTTTTTEPPPIVQVIGLPAPTPRNNYKPSSAAAA 614 >AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein protein. Length = 373 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/33 (24%), Positives = 14/33 (42%) Frame = -1 Query: 735 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 637 W+ P T+ P++ PPP + +T Sbjct: 222 WIDPTATTTTHAPTTTTTWSDLPPPPPTTTTTT 254 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 23.0 bits (47), Expect = 9.8 Identities = 13/43 (30%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = -1 Query: 711 TSKIPSSMVRMDTSKVPPPRSKISTFRSPVPFLS-RP*AIAAA 586 T+K+ + M T+ PPP ++ +P P + +P + AAA Sbjct: 571 TTKLSTMMTTTTTTTEPPPIVQVIGLPAPTPRNNYKPSSAAAA 613 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 817,185 Number of Sequences: 2352 Number of extensions: 17584 Number of successful extensions: 48 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 47 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 48 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75676146 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -