BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021031 (738 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 25 0.56 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 21 9.1 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 9.1 AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc fi... 21 9.1 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 25.4 bits (53), Expect = 0.56 Identities = 17/52 (32%), Positives = 24/52 (46%) Frame = +2 Query: 452 SLSRQNCAECSHHGSRVLQDSQRQATKDAGTISGLNVLRIINEPTAAAIAYG 607 SL R+ + + VL+ Q +A K A + N II+EPT YG Sbjct: 332 SLRRKRQKINNSQNALVLRHVQAEAEKHAAMLYQYNFNIIISEPTERISPYG 383 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 21.4 bits (43), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +3 Query: 246 QQHIFDAKRLIGRKXEDATVQ 308 QQHI KR++G D V+ Sbjct: 410 QQHIMSEKRIMGEADCDFVVK 430 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.4 bits (43), Expect = 9.1 Identities = 14/60 (23%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Frame = +2 Query: 500 VLQDSQRQATKDAGTI-SGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFDV 676 V+Q+ K A + + LN+ I P+ Y + + N+L DL G ++ Sbjct: 768 VVQEISSDGLKFAFDVKTTLNISDIALYPSQTTHGYDIYASSIDKENILFLDLSTGKVEM 827 >AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc finger domain-Z3 isoform protein. Length = 92 Score = 21.4 bits (43), Expect = 9.1 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -3 Query: 61 PFCIFNQSCYLFLKQ 17 P+C N SCY LK+ Sbjct: 9 PYCRRNFSCYYSLKR 23 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 211,894 Number of Sequences: 438 Number of extensions: 4787 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23023035 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -