BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021030 (758 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g61600.1 68414.m06941 expressed protein 29 2.5 At5g54800.1 68418.m06826 glucose-6-phosphate/phosphate transloca... 29 3.4 At1g73325.1 68414.m08487 trypsin and protease inhibitor family p... 29 3.4 At4g22850.1 68417.m03300 expressed protein 28 5.9 At1g13300.1 68414.m01544 myb family transcription factor contain... 28 7.7 >At1g61600.1 68414.m06941 expressed protein Length = 421 Score = 29.5 bits (63), Expect = 2.5 Identities = 15/44 (34%), Positives = 19/44 (43%) Frame = -1 Query: 602 LQLPLKPGSVLHRLGCPGPARLPFRPVHRISVVTSAASWLSGGR 471 +Q P PG + G P L F V R+ V W+ GGR Sbjct: 311 VQGPRGPGERRRKTGLRSPVGLSFVVVERMRRVMEEGGWVGGGR 354 >At5g54800.1 68418.m06826 glucose-6-phosphate/phosphate translocator, putative identical to glucose 6 phosphate/phosphate translocator [Arabidopsis thaliana] gi|7229675|gb|AAF42936 Length = 388 Score = 29.1 bits (62), Expect = 3.4 Identities = 16/46 (34%), Positives = 23/46 (50%) Frame = -2 Query: 409 PSSANPRQLCLVASRNLHVGGRIDASLSTSPLEAYKLKAYSSRPHP 272 PS+ P++ L S+ LH+ + A EAY +A S PHP Sbjct: 34 PSTELPKRTVLAVSKPLHLSSSLRAKSPVVRCEAY--EADRSEPHP 77 >At1g73325.1 68414.m08487 trypsin and protease inhibitor family protein / Kunitz family protein similar to Dr4 [Arabidopsis thaliana] GI:469114; contains Pfam profile PF00197: Trypsin and protease inhibitor Length = 222 Score = 29.1 bits (62), Expect = 3.4 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +1 Query: 208 TPGGSTPGNSDRTTGQFLCKSLDVVEKSMPSI 303 T GG P N + +T Q LC +LD+V+ S P + Sbjct: 55 TGGGLIPSNRNLST-QDLCLNLDIVQSSSPFV 85 >At4g22850.1 68417.m03300 expressed protein Length = 296 Score = 28.3 bits (60), Expect = 5.9 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -2 Query: 145 VGLPYFEVQFFCHSNTGHDDRY 80 V LPYF Q FCH G +RY Sbjct: 148 VSLPYFIGQLFCHKIQGWLERY 169 >At1g13300.1 68414.m01544 myb family transcription factor contains Pfam domain, PF00249: Myb-like DNA-binding domain Length = 344 Score = 27.9 bits (59), Expect = 7.7 Identities = 17/42 (40%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +1 Query: 130 NKGVQPSLSLVYVPG*EVP-SDRHTASTPGGSTPGNSDRTTG 252 N G + V V G VP SD T T GG+T ++ TTG Sbjct: 246 NNGNSQTQHFVVVGGLWVPQSDYSTGKTTGGATTSSTTTTTG 287 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,976,285 Number of Sequences: 28952 Number of extensions: 373251 Number of successful extensions: 1017 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 988 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1017 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1692519896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -