BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021027 (672 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC30D11.14c |||RNA-binding protein |Schizosaccharomyces pombe|... 36 0.007 SPCC613.07 |||zf-HIT|Schizosaccharomyces pombe|chr 3|||Manual 30 0.35 SPCC1672.07 |||U3 snoRNP-associated protein Utp21 |Schizosacchar... 25 9.9 >SPAC30D11.14c |||RNA-binding protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 534 Score = 35.5 bits (78), Expect = 0.007 Identities = 20/59 (33%), Positives = 28/59 (47%) Frame = -2 Query: 608 RFRSDAAADRYSTRNGLSVSEHVKXXXRMDISLRLAGRSRGPGTGSMWSASSAGSTPRH 432 RF D+ + R S R+G + R + L+ RSR P S W +SS+G P H Sbjct: 21 RFTEDSYSRRDSQRSGNEAPRESRYY-RKEEHLQERSRSRSPARDSRWKSSSSGFAPAH 78 >SPCC613.07 |||zf-HIT|Schizosaccharomyces pombe|chr 3|||Manual Length = 345 Score = 29.9 bits (64), Expect = 0.35 Identities = 14/56 (25%), Positives = 30/56 (53%) Frame = +2 Query: 347 NERTTHQDLTEVKCVYTVLMHCHSVPELRDEVYCQLMKQTTSNRSQAPDSCQRAGD 514 +E +T +DLT+ T++ H H E ++++ +L+++ + SQ + A D Sbjct: 141 HESSTSKDLTDEASENTIITHSHPESEPLEKIFRKLVEENSEMNSQVSKANIHAPD 196 >SPCC1672.07 |||U3 snoRNP-associated protein Utp21 |Schizosaccharomyces pombe|chr 3|||Manual Length = 902 Score = 25.0 bits (52), Expect = 9.9 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 Query: 40 DSVSGGARCRSLR*STTGTYLAT 108 DS+S + C SL + TG YLAT Sbjct: 608 DSISTPSVCTSLTFAPTGDYLAT 630 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,470,219 Number of Sequences: 5004 Number of extensions: 44576 Number of successful extensions: 128 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 126 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 128 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 307866294 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -