BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021027 (672 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF427621-5|ABO09853.1| 62|Anopheles gambiae tal-like protein A... 23 8.8 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 23 8.8 >EF427621-5|ABO09853.1| 62|Anopheles gambiae tal-like protein AA protein. Length = 62 Score = 23.0 bits (47), Expect = 8.8 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = +2 Query: 134 NPTGITRNPESGLVTQEQSETQRVDLEGADHSR 232 +PTG+ R P SG + ++S + +H R Sbjct: 6 DPTGMYRRPGSGASSSQRSPFHHHHQQQQNHQR 38 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 23.0 bits (47), Expect = 8.8 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 4/49 (8%) Frame = +1 Query: 475 PVPGPRLL----PASRRLMSILXXXFTCSDTLRPFLVEYLSAAASDRKR 609 P P P LL PA + L+S+ S +L+P + + S RKR Sbjct: 373 PEPSPVLLRSPTPAKKPLISVAPASKLLSKSLQPSTLPTRPSPKSSRKR 421 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 667,725 Number of Sequences: 2352 Number of extensions: 13611 Number of successful extensions: 31 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67322955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -