BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= NV021024
(755 letters)
Database: uniref50
1,657,284 sequences; 575,637,011 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
UniRef50_A2DVH1 Cluster: PHD-finger family protein; n=1; Trichom... 35 2.5
>UniRef50_A2DVH1 Cluster: PHD-finger family protein; n=1;
Trichomonas vaginalis G3|Rep: PHD-finger family protein
- Trichomonas vaginalis G3
Length = 741
Score = 34.7 bits (76), Expect = 2.5
Identities = 19/64 (29%), Positives = 27/64 (42%), Gaps = 2/64 (3%)
Frame = -1
Query: 542 VCKKCLRLPKISKKLCTTXNV--LFCKCAKNACYSLVRKYLCSCKFLLYKFVKMTGFEVT 369
+C C R + LC L C+C KN Y++ CK L+K + GF +
Sbjct: 300 ICVNCPRASSTEQFLCPFCQAKRLRCRCKKNKSYNIPIVQCSHCKLYLHKQCEGLGFGII 359
Query: 368 TKYF 357
K F
Sbjct: 360 PKPF 363
Database: uniref50
Posted date: Oct 5, 2007 11:19 AM
Number of letters in database: 575,637,011
Number of sequences in database: 1,657,284
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 568,832,687
Number of Sequences: 1657284
Number of extensions: 9998402
Number of successful extensions: 22037
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 21091
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 22029
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 62558016040
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -