BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021024 (755 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC15A10.03c |rhp54|rad54|Rad54 homolog Rhp54|Schizosaccharomyc... 28 1.3 SPAC23H3.04 |||conserved fungal protein|Schizosaccharomyces pomb... 27 3.8 SPCC895.06 |||RNA polymerase II elongator complex subunit Elp2 |... 26 5.0 >SPAC15A10.03c |rhp54|rad54|Rad54 homolog Rhp54|Schizosaccharomyces pombe|chr 1|||Manual Length = 852 Score = 28.3 bits (60), Expect = 1.3 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +1 Query: 358 KYLVVTSNPVIFTNLYNKNLQLHKYFLT 441 KYL V V+F NL L L+K+F+T Sbjct: 516 KYLPVKYEHVVFCNLSEFQLSLYKHFIT 543 >SPAC23H3.04 |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 300 Score = 26.6 bits (56), Expect = 3.8 Identities = 11/37 (29%), Positives = 22/37 (59%) Frame = -1 Query: 431 YLCSCKFLLYKFVKMTGFEVTTKYFYPSTKIIKKNYS 321 Y+C ++L+K ++M + T K +Y S+K + +S Sbjct: 236 YVCGIPYILFKIIRM--YTSTQKEYYASSKQMITTFS 270 >SPCC895.06 |||RNA polymerase II elongator complex subunit Elp2 |Schizosaccharomyces pombe|chr 3|||Manual Length = 760 Score = 26.2 bits (55), Expect = 5.0 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = -1 Query: 539 CKKCLRLPKISKKLCTTXNVLFCKCAKNAC 450 C K + L LC N++ C C+ ++C Sbjct: 92 CIKTIELEATVNCLCVNENLVVCGCSNSSC 121 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,540,208 Number of Sequences: 5004 Number of extensions: 47873 Number of successful extensions: 91 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 89 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 91 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 361294920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -