BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021024 (755 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_1140| Best HMM Match : CUB (HMM E-Value=0) 28 7.1 SB_4456| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.4 >SB_1140| Best HMM Match : CUB (HMM E-Value=0) Length = 410 Score = 28.3 bits (60), Expect = 7.1 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = -1 Query: 533 KCLRLPKISKKLCTTXNVLFCKC-AKNACYSLVRKYLCSCKFL 408 +CL L K++ N F A N C SL++ C+C F+ Sbjct: 287 QCLSLIKVAAGFRVKLNFTFMDIEAGNPCKSLIQNQTCTCDFV 329 >SB_4456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 673 Score = 27.9 bits (59), Expect = 9.4 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -1 Query: 542 VCKKCLRLPKISKKLCTTXNVLFCK 468 VCK+CLR+ +K N++ CK Sbjct: 55 VCKQCLRVTHEQQKCVFNDNIMMCK 79 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,835,138 Number of Sequences: 59808 Number of extensions: 319251 Number of successful extensions: 899 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 859 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 897 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2058295707 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -