BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021024 (755 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor... 27 0.62 AY391745-1|AAR28995.1| 460|Anopheles gambiae putative GPCR prot... 24 5.8 >DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor 22 protein. Length = 467 Score = 27.1 bits (57), Expect = 0.62 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +1 Query: 358 KYLVVTSNPVIFTNLY 405 KYL+VT P++F LY Sbjct: 185 KYLIVTGKPIVFPKLY 200 >AY391745-1|AAR28995.1| 460|Anopheles gambiae putative GPCR protein. Length = 460 Score = 23.8 bits (49), Expect = 5.8 Identities = 12/42 (28%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = -2 Query: 592 KILVIDVPIFICDYNKSYVRNVYVYQKLVKNY--VLLXMFCF 473 K+L+I +F+C SYV V + + +Y +L+ +C+ Sbjct: 322 KMLLIVSSVFVCLNLPSYVMRVRAFVETGHSYLTILVQYYCY 363 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 627,339 Number of Sequences: 2352 Number of extensions: 11428 Number of successful extensions: 20 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78170964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -