BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021024 (755 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81595-4|CAB04751.1| 91|Caenorhabditis elegans Hypothetical pr... 28 6.2 Z77132-4|CAB00862.3| 536|Caenorhabditis elegans Hypothetical pr... 28 8.2 AF083225-1|AAD03683.1| 536|Caenorhabditis elegans nuclear recep... 28 8.2 >Z81595-4|CAB04751.1| 91|Caenorhabditis elegans Hypothetical protein T22H2.4 protein. Length = 91 Score = 28.3 bits (60), Expect = 6.2 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 3/47 (6%) Frame = -1 Query: 542 VCKKCLRLPKISKKLC--TTXNV-LFCKCAKNACYSLVRKYLCSCKF 411 +CKKC ++ KI K+C NV CK C +K L KF Sbjct: 8 MCKKCAKMCKICAKVCKKCAKNVQKKCKKCGKMCKKCAKKCLKKSKF 54 >Z77132-4|CAB00862.3| 536|Caenorhabditis elegans Hypothetical protein F54D1.4 protein. Length = 536 Score = 27.9 bits (59), Expect = 8.2 Identities = 14/49 (28%), Positives = 26/49 (53%) Frame = +1 Query: 361 YLVVTSNPVIFTNLYNKNLQLHKYFLTKL*HAFFAHLQNKTLXVVHNFL 507 Y+V+++ + +N N++L L + L++L H +NKT N L Sbjct: 287 YIVLSAESTVLSNSLNESLSLARENLSELLFKVIKHSRNKTSISAANSL 335 >AF083225-1|AAD03683.1| 536|Caenorhabditis elegans nuclear receptor NHR-7 protein. Length = 536 Score = 27.9 bits (59), Expect = 8.2 Identities = 14/49 (28%), Positives = 26/49 (53%) Frame = +1 Query: 361 YLVVTSNPVIFTNLYNKNLQLHKYFLTKL*HAFFAHLQNKTLXVVHNFL 507 Y+V+++ + +N N++L L + L++L H +NKT N L Sbjct: 287 YIVLSAESTVLSNSLNESLSLARENLSELLFKVIKHSRNKTSISAANSL 335 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,880,295 Number of Sequences: 27780 Number of extensions: 265047 Number of successful extensions: 555 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 542 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 554 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1798543458 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -