BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021023 (623 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578797-1|AAT07302.1| 304|Anopheles gambiae activin protein. 27 0.64 AJ297933-1|CAC35453.2| 392|Anopheles gambiae Ag9 protein protein. 24 3.4 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 23 6.0 >AY578797-1|AAT07302.1| 304|Anopheles gambiae activin protein. Length = 304 Score = 26.6 bits (56), Expect = 0.64 Identities = 15/42 (35%), Positives = 19/42 (45%) Frame = +2 Query: 491 DWLPKPHSPGARGTEGVCHRSGRGLRPEGRQGYRQMRHQGRA 616 DW+ +PH A +G CH + R E Q R QG A Sbjct: 196 DWIIRPHGYYANYCKGSCHLADR-FSSEYHYVIDQYRRQGGA 236 >AJ297933-1|CAC35453.2| 392|Anopheles gambiae Ag9 protein protein. Length = 392 Score = 24.2 bits (50), Expect = 3.4 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +3 Query: 381 PRRAEATRHTQTRDEGVLC 437 PRR R+ +TRDE + C Sbjct: 324 PRRCSRARYNETRDEHMGC 342 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 23.4 bits (48), Expect = 6.0 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = -1 Query: 572 PDEVHVHFGGILLQFPEHLGYV 507 P+EV + FGG+ + F + Y+ Sbjct: 788 PEEVFITFGGVNVPFSRSIKYL 809 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 572,900 Number of Sequences: 2352 Number of extensions: 10234 Number of successful extensions: 28 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 60632475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -