BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021021 (795 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 26 0.40 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 22 6.5 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 22 6.5 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 21 8.6 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 25.8 bits (54), Expect = 0.40 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +2 Query: 437 SQQMYSYKMSGGFTSNGNNTT 499 S QM SY+ +G T +G+NT+ Sbjct: 242 SPQMQSYRPTGNITPHGSNTS 262 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 21.8 bits (44), Expect = 6.5 Identities = 10/35 (28%), Positives = 16/35 (45%) Frame = +2 Query: 356 SWWPSSAGELQHQQQLNEEIGTSTATTSQQMYSYK 460 SW S++ + +E++ T T T Y YK Sbjct: 12 SWLKSNSSLAGFEVNSSEQLTTPTPTDINSFYFYK 46 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 21.8 bits (44), Expect = 6.5 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = +2 Query: 428 ATTSQQMYSYKMSGGFTSNGNNTTPS 505 A+ M + M GG NGN T S Sbjct: 47 ASFGSSMLNSGMPGGMAMNGNGMTSS 72 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 21.4 bits (43), Expect = 8.6 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -1 Query: 501 GVVLFPLDVKPPDILYEYIC 442 GVVL PLD + +I + IC Sbjct: 450 GVVLNPLDARCNEIRPDAIC 469 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,633 Number of Sequences: 336 Number of extensions: 3530 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21583952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -