BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021021 (795 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 24 1.9 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 23 2.5 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 5.7 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 22 7.5 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 22 7.5 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 10.0 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 23.8 bits (49), Expect = 1.9 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 599 ACCESTPPDEYHHCCR 552 +C + T PDE H CR Sbjct: 628 SCRQGTVPDETHSACR 643 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 23.4 bits (48), Expect = 2.5 Identities = 5/7 (71%), Positives = 6/7 (85%) Frame = -1 Query: 399 CCWCCSS 379 CCWCC + Sbjct: 12 CCWCCDN 18 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 22.2 bits (45), Expect = 5.7 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +3 Query: 498 LPVIISNYV*F*HKGSFTSATMV 566 LP +ISNY+ +G F + M+ Sbjct: 897 LPTLISNYIEAVKEGKFMNVNML 919 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.8 bits (44), Expect = 7.5 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +2 Query: 38 LFVIKGILVCFLNKVFCL 91 + ++ G+LVC+LN L Sbjct: 555 IILLAGVLVCYLNTFLLL 572 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.8 bits (44), Expect = 7.5 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +2 Query: 38 LFVIKGILVCFLNKVFCL 91 + ++ G+LVC+LN L Sbjct: 645 IILLAGVLVCYLNTFLLL 662 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 10.0 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +3 Query: 612 VAESVKSRKRSKQSTSERYSTESSVDPTTTAA 707 VAE + R+R KQ YS S + T A Sbjct: 36 VAEELMGRRRWKQYQDTLYSGTRSSESLTAQA 67 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 200,458 Number of Sequences: 438 Number of extensions: 4465 Number of successful extensions: 17 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25125039 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -