BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021020 (832 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 23 2.6 AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alph... 23 3.5 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 8.0 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 8.0 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 23.4 bits (48), Expect = 2.6 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +1 Query: 109 NNIKKGHAMATSKSTNTYNRQNWEDADFPILCQTCLGDNPY 231 NNI+ + ++ + +T NRQ FPI C T LG + Sbjct: 39 NNIETKNQLSPF-NIDTPNRQKILKDGFPIKCGTFLGSGGF 78 >AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alpha protein precursor protein. Length = 153 Score = 23.0 bits (47), Expect = 3.5 Identities = 15/54 (27%), Positives = 24/54 (44%), Gaps = 4/54 (7%) Frame = +3 Query: 258 KECKICS----RPFTVFRWCPGARMRFKKTEICQTCSKLKNVCQTCLLDLEYGL 407 + C C R +V +CP A+ KK T + L+ +C+ C EY + Sbjct: 73 RSCMCCQESGEREASVSLFCPRAKPGEKKFRKVITKAPLECMCRPCTSVEEYAI 126 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.8 bits (44), Expect = 8.0 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = -1 Query: 313 APGHHRNTVKGLEHILHSLPIFL*SF*CKGYLQDM 209 A GH N V G+ +L + + L F + QD+ Sbjct: 67 ADGHPVNDVPGVRRVLRNGTLVLLPFPAAAFRQDV 101 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 8.0 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = -1 Query: 313 APGHHRNTVKGLEHILHSLPIFL*SF*CKGYLQDM 209 A GH N V G+ +L + + L F + QD+ Sbjct: 67 ADGHPVNDVPGVRRVLRNGTLVLLPFPAAAFRQDV 101 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 233,321 Number of Sequences: 438 Number of extensions: 4873 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26581563 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -