BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021015 (778 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1792 + 29569623-29569737,29569848-29569981,29570117-295702... 33 0.25 06_01_0675 + 4937309-4937354,4937606-4937718,4937810-4937905,493... 31 0.77 08_02_1284 - 25864049-25864202,25864690-25864880,25865053-258658... 28 7.2 08_02_0956 + 23026108-23027146,23027255-23027395,23029334-230295... 28 7.2 12_01_0340 - 2605770-2605916,2606353-2606595,2607260-2607531,260... 28 9.5 >07_03_1792 + 29569623-29569737,29569848-29569981,29570117-29570284, 29572817-29573003,29573098-29573422,29573591-29574368, 29574897-29575022 Length = 610 Score = 33.1 bits (72), Expect = 0.25 Identities = 16/36 (44%), Positives = 22/36 (61%) Frame = +2 Query: 536 RNLDVTLFRNELELQNNLSQALVQNLSEQDLRNLDL 643 R++ T RNE LQNN +A ++NL E +R DL Sbjct: 228 RSIKPTDRRNEYPLQNNSKEAAMENLEESSVRAADL 263 >06_01_0675 + 4937309-4937354,4937606-4937718,4937810-4937905, 4938003-4938059,4938145-4938300,4938402-4938486, 4938727-4938817,4938896-4939060,4939150-4939345, 4939593-4939731,4940187-4941874,4942575-4942765, 4942850-4942994 Length = 1055 Score = 31.5 bits (68), Expect = 0.77 Identities = 18/69 (26%), Positives = 36/69 (52%) Frame = +2 Query: 569 LELQNNLSQALVQNLSEQDLRNLDLSRINEVQLQNLRTDIPLHHESNVSQGGRQLDQELM 748 L+ Q Q +Q LS+ +++ L + ++Q QN+ + + H+S + Q Q QE++ Sbjct: 633 LQSQQQQQQLQLQQLSQPEVQ---LQLLQKIQQQNMLSQLNPQHQSQLIQQLSQKSQEIL 689 Query: 749 QAESSAFRF 775 Q + +F Sbjct: 690 QQQILQHQF 698 >08_02_1284 - 25864049-25864202,25864690-25864880,25865053-25865895, 25865953-25866896,25867052-25867190,25867259-25867334, 25867666-25867788,25867869-25867952,25868145-25868235, 25868448-25868532,25868620-25868784,25868872-25868928, 25870141-25870302 Length = 1037 Score = 28.3 bits (60), Expect = 7.2 Identities = 12/50 (24%), Positives = 25/50 (50%) Frame = +3 Query: 255 EENYKMYMDSLQKHQLESEYHTQISMEQLHQAMQSSLNNSGIVHNFQLPL 404 ++ + +Q+ Q + H QI ++ +H +M +S+N H +L L Sbjct: 556 QQQQTQQLQPVQQVQQSVQEHQQIKIQPVHVSMDASMNTQVADHQMKLQL 605 >08_02_0956 + 23026108-23027146,23027255-23027395,23029334-23029566, 23029652-23030989 Length = 916 Score = 28.3 bits (60), Expect = 7.2 Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = -3 Query: 422 GHLPWGEWQLEVVDYTGVVQRGLHSLM-QLLHG 327 G +P G+W VD TG+V+R + M +L++G Sbjct: 148 GAVPRGDWSTWTVDVTGLVKRPMRLTMDELVNG 180 >12_01_0340 - 2605770-2605916,2606353-2606595,2607260-2607531, 2607691-2607733,2607822-2607899,2608026-2608085, 2608272-2608331,2609440-2609577,2609655-2609767, 2610333-2610569,2610867-2610918 Length = 480 Score = 27.9 bits (59), Expect = 9.5 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +3 Query: 282 SLQKHQLESEYHTQISMEQLHQAMQSSLNNSGIVHN 389 SLQ+ ++E +EQLHQ++ ++ N G V N Sbjct: 370 SLQQSSQQAEEALSQGLEQLHQSLAETVANGGSVVN 405 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,740,144 Number of Sequences: 37544 Number of extensions: 367472 Number of successful extensions: 933 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 912 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 933 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2080154268 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -