BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021013 (712 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 24 1.2 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 24 1.6 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 24 1.6 AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. 24 1.6 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 23 3.8 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 24.2 bits (50), Expect = 1.2 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 Query: 447 NVNGLCEISVDRFC 488 ++ LC ISVDRFC Sbjct: 128 SILNLCMISVDRFC 141 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 23.8 bits (49), Expect = 1.6 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -1 Query: 502 KRIIIQNRSTEISHKPFTLKHIMFK*KHHVK 410 K +I+ R ++HKPFT HI+ +VK Sbjct: 482 KNTMIKARQYRLNHKPFTY-HIVVNSDKNVK 511 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 23.8 bits (49), Expect = 1.6 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -1 Query: 502 KRIIIQNRSTEISHKPFTLKHIMFK*KHHVK 410 K +I+ R ++HKPFT HI+ +VK Sbjct: 482 KNTMIKARQYRLNHKPFTY-HIVVNSDKNVK 511 >AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. Length = 226 Score = 23.8 bits (49), Expect = 1.6 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -1 Query: 502 KRIIIQNRSTEISHKPFTLKHIMFK*KHHVK 410 K +I+ R ++HKPFT HI+ +VK Sbjct: 108 KNTMIKARQYRLNHKPFTY-HIVVNSDKNVK 137 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 22.6 bits (46), Expect = 3.8 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +2 Query: 5 SEVSIHLSYISCPVRSLTYIH 67 S ++I + YISCP S+ + H Sbjct: 180 SILAIKVYYISCPEISVNFAH 200 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 177,989 Number of Sequences: 438 Number of extensions: 3720 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21926700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -