BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021011 (753 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 92 5e-19 SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 1e-16 SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) 67 2e-11 SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_43842| Best HMM Match : RNB (HMM E-Value=0) 57 2e-08 SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) 56 3e-08 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_37351| Best HMM Match : DEAD (HMM E-Value=0) 50 2e-06 SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) 49 5e-06 SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) 48 6e-06 SB_52320| Best HMM Match : DEAD (HMM E-Value=0) 48 8e-06 SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_9558| Best HMM Match : DEAD (HMM E-Value=0) 44 2e-04 SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) 42 7e-04 SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) 42 7e-04 SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_17563| Best HMM Match : DEAD (HMM E-Value=0) 38 0.007 SB_2247| Best HMM Match : DEAD (HMM E-Value=0) 38 0.007 SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) 38 0.012 SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) 37 0.015 SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) 36 0.047 SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) 33 0.19 SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) 33 0.25 SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_26138| Best HMM Match : RhoGEF (HMM E-Value=0.0011) 29 4.1 SB_32980| Best HMM Match : DEAD (HMM E-Value=0) 28 7.1 SB_19782| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.4 SB_8125| Best HMM Match : MFS_1 (HMM E-Value=3.2e-07) 28 9.4 SB_19342| Best HMM Match : Keratin_B2 (HMM E-Value=0.41) 28 9.4 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 91.9 bits (218), Expect = 5e-19 Identities = 41/67 (61%), Positives = 52/67 (77%) Frame = +2 Query: 551 YILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTCVFGGAPK 730 +ILP IVHIN+QP ++ GDGPI LVL PTRELAQQ+Q+VA G +R+TC++GGAPK Sbjct: 113 FILPGIVHINHQPLLQPGDGPIVLVLCPTRELAQQVQEVAYSVGKHCKLRSTCIYGGAPK 172 Query: 731 REQARDL 751 Q R+L Sbjct: 173 GPQIREL 179 Score = 61.3 bits (142), Expect = 8e-10 Identities = 27/56 (48%), Positives = 37/56 (66%) Frame = +1 Query: 313 RSPYEVEEYRNNHEVTVSGVEVHNPIQXFEEANFPDYVQQGVKTMGYKEPTPIQAQ 480 R +EV+ YR + ++TV+G V P+ FEE+ FPDY+Q K G+ EPT IQAQ Sbjct: 57 RGQHEVDAYRRSKDLTVNGRNVPKPVTTFEESAFPDYIQSYFKREGFTEPTMIQAQ 112 >SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 790 Score = 83.8 bits (198), Expect = 1e-16 Identities = 40/76 (52%), Positives = 51/76 (67%) Frame = +2 Query: 524 QTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRN 703 +TGSGKT A++ PA+VHI +QP ++ GDGPI L+ APTREL QQI A FG + Sbjct: 562 KTGSGKTAAFLWPALVHIMDQPELQVGDGPIVLICAPTRELCQQIYTEARRFGKAYNIHV 621 Query: 704 TCVFGGAPKREQARDL 751 VFGG K EQ++ L Sbjct: 622 VAVFGGGNKYEQSKAL 637 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/89 (34%), Positives = 48/89 (53%) Frame = +1 Query: 241 PRLGFVSLQPFNKNFYDPHPTVLKRSPYEVEEYRNNHEVTVSGVEVHNPIQXFEEANFPD 420 P + +PFNKNFY+ HP + K+S E+++ R + VSG P F F + Sbjct: 467 PEKSKIDYKPFNKNFYEEHPEITKQSKQEIDDLRKKMGIKVSGAMPARPCISFAHFGFDE 526 Query: 421 YVQQGVKTMGYKEPTPIQAQGWPIAMSGK 507 + ++ + Y +PT IQ Q PIA+SG+ Sbjct: 527 QMMASIRKLEYTQPTQIQCQALPIALSGR 555 >SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) Length = 428 Score = 66.9 bits (156), Expect = 2e-11 Identities = 35/73 (47%), Positives = 45/73 (61%), Gaps = 4/73 (5%) Frame = +2 Query: 524 QTGSGKTLAYILPAIVHINNQPPIRRGD----GPIALVLAPTRELAQQIQQVAADFGHTS 691 +TGSGKT A+ +P +V I P I R + GP AL+LAPTRELAQQI++ FG Sbjct: 146 ETGSGKTAAFAIPLLVWIMGLPKIERDNDADQGPYALILAPTRELAQQIEEEILKFGRPL 205 Query: 692 YVRNTCVFGGAPK 730 +R V GGA + Sbjct: 206 GIRTVSVIGGADR 218 Score = 49.6 bits (113), Expect = 3e-06 Identities = 20/57 (35%), Positives = 34/57 (59%) Frame = +1 Query: 337 YRNNHEVTVSGVEVHNPIQXFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGK 507 +R + ++ G + PI+ ++EA PD + + V +GYK+PTPIQ Q PI + + Sbjct: 83 FREDFNISTKGGRIPFPIRKWKEAQIPDSILEIVDKLGYKDPTPIQRQAIPIGLQNR 139 >SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 58.8 bits (136), Expect = 4e-09 Identities = 30/85 (35%), Positives = 47/85 (55%), Gaps = 1/85 (1%) Frame = +1 Query: 256 VSLQPFNKNFYDPHPTVLKRSPYEVEEYRNNHE-VTVSGVEVHNPIQXFEEANFPDYVQQ 432 V QPF K+FY P + K +P E +E+R + E + V G P++ + + + Sbjct: 59 VVYQPFRKDFYVEVPELAKMTPEETDEFRLSLENIHVRGKNAPKPVKTWAQTGVQLKILD 118 Query: 433 GVKTMGYKEPTPIQAQGWPIAMSGK 507 +K Y++PTPIQAQ P+ MSG+ Sbjct: 119 VLKKNSYEKPTPIQAQAIPVIMSGR 143 Score = 44.8 bits (101), Expect = 8e-05 Identities = 26/71 (36%), Positives = 35/71 (49%) Frame = +2 Query: 539 KTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTCVFG 718 K +Y P + P I G IA+V+ PTRELA QI + F + +R CV+G Sbjct: 121 KKNSYEKPTPIQAQAIPVIMSGRDMIAIVMTPTRELAIQIHRECKKFCKPNNLRCVCVYG 180 Query: 719 GAPKREQARDL 751 G EQ +L Sbjct: 181 GTGISEQIAEL 191 >SB_43842| Best HMM Match : RNB (HMM E-Value=0) Length = 1238 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = +2 Query: 524 QTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQI 658 +TGSGKTLAY LP + + + P GD P+AL+L PTREL QQ+ Sbjct: 117 ETGSGKTLAYSLPLCMLLRTKAPSNPGDTPVALILTPTRELMQQV 161 Score = 46.4 bits (105), Expect = 2e-05 Identities = 23/79 (29%), Positives = 39/79 (49%) Frame = +1 Query: 271 FNKNFYDPHPTVLKRSPYEVEEYRNNHEVTVSGVEVHNPIQXFEEANFPDYVQQGVKTMG 450 F ++YD + V + S V+E R + + + G + PI+ F + N P + + Sbjct: 32 FMWSYYDENEKVSRLSDEVVDEIRWKNGIHIEGEDCPKPIESFHDLNLPPELSTYLAKKN 91 Query: 451 YKEPTPIQAQGWPIAMSGK 507 ++ PTPIQ Q MSG+ Sbjct: 92 FQVPTPIQMQSLSCVMSGR 110 >SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) Length = 500 Score = 56.0 bits (129), Expect = 3e-08 Identities = 24/74 (32%), Positives = 41/74 (55%) Frame = +1 Query: 286 YDPHPTVLKRSPYEVEEYRNNHEVTVSGVEVHNPIQXFEEANFPDYVQQGVKTMGYKEPT 465 Y HPT+ + +V++ R+ E+ V G V +P+ F +F + + + + GY PT Sbjct: 161 YKEHPTIAALTAEQVKQLRDKMEIKVKGEHVVSPVLEFFHCSFNESLSKNLSNHGYHSPT 220 Query: 466 PIQAQGWPIAMSGK 507 PIQ Q P+ +SG+ Sbjct: 221 PIQMQVLPVLLSGR 234 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 54.4 bits (125), Expect = 9e-08 Identities = 31/76 (40%), Positives = 41/76 (53%) Frame = +2 Query: 524 QTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRN 703 QTGSGKT AY+LP + + Q P+AL +APTRELA+QI A F + ++ Sbjct: 524 QTGSGKTAAYMLPVLTSLIKQGLNAPPRSPLALCVAPTRELAKQIYIEARKFSDHTPIKV 583 Query: 704 TCVFGGAPKREQARDL 751 +GG QA L Sbjct: 584 CVCYGGVSVPYQASQL 599 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = +1 Query: 361 VSGVEVHNPIQXFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGK 507 VSG I F E F + + + GY+ PTP+Q PI M+G+ Sbjct: 469 VSGENQPPKITSFNELPFGEQLMANISRAGYRRPTPVQKAALPIVMAGR 517 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 54.4 bits (125), Expect = 9e-08 Identities = 31/80 (38%), Positives = 40/80 (50%), Gaps = 4/80 (5%) Frame = +2 Query: 524 QTGSGKTLAYILPAIVHINN----QPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTS 691 QTGSGKT A++LP + + N P A+ +APTRELA QI A F H + Sbjct: 756 QTGSGKTAAFLLPVMTSMMNAGLTSSSFSETQTPQAMCIAPTRELANQIYLEARKFAHGT 815 Query: 692 YVRNTCVFGGAPKREQARDL 751 +R +GG Q R L Sbjct: 816 MLRPVVCYGGVSVSHQLRQL 835 Score = 41.5 bits (93), Expect = 7e-04 Identities = 21/52 (40%), Positives = 28/52 (53%) Frame = +1 Query: 352 EVTVSGVEVHNPIQXFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGK 507 EV VSG I FEEAN + V+ YK+PTP+Q PI ++G+ Sbjct: 698 EVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGR 749 >SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 51.2 bits (117), Expect = 9e-07 Identities = 31/79 (39%), Positives = 42/79 (53%), Gaps = 1/79 (1%) Frame = +2 Query: 518 RTQTGSGKTLAYILPAIVHINNQPPIRRG-DGPIALVLAPTRELAQQIQQVAADFGHTSY 694 + Q+G+GKT + + + I+ + G D ALVLAPTRELAQQIQ+V G + Sbjct: 128 QAQSGTGKTATFAISILQEIDTNYKDKNGCDCCQALVLAPTRELAQQIQKVVLALGDYMH 187 Query: 695 VRNTCVFGGAPKREQARDL 751 V+ GG RE L Sbjct: 188 VKCHACIGGTNVREDRMKL 206 >SB_37351| Best HMM Match : DEAD (HMM E-Value=0) Length = 688 Score = 50.0 bits (114), Expect = 2e-06 Identities = 27/75 (36%), Positives = 44/75 (58%), Gaps = 1/75 (1%) Frame = +2 Query: 518 RTQTGSGKTLAYILPAIVHINN-QPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSY 694 + +TG+GKTL++ LP + + + + +RG P LV+APTRELA+Q+ + S Sbjct: 116 QARTGTGKTLSFALPLVEKLQDGKLSQKRGRAPKVLVMAPTRELAKQVGNEFENL--KSN 173 Query: 695 VRNTCVFGGAPKREQ 739 + C++GG P Q Sbjct: 174 LEVYCIYGGMPYEPQ 188 >SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) Length = 1058 Score = 48.8 bits (111), Expect = 5e-06 Identities = 22/64 (34%), Positives = 34/64 (53%), Gaps = 4/64 (6%) Frame = +1 Query: 325 EVEEYRNNHEVTVSGVEVHNPIQXF----EEANFPDYVQQGVKTMGYKEPTPIQAQGWPI 492 ++ +R+ + V G +V +P++ F E FPDY+ V+ GY PTPIQ Q P+ Sbjct: 137 KINLFRHEQHIYVKGADVPDPVETFSQLIERYGFPDYIIHNVQERGYTTPTPIQMQATPL 196 Query: 493 AMSG 504 G Sbjct: 197 MAHG 200 Score = 27.9 bits (59), Expect = 9.4 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 3/39 (7%) Frame = +2 Query: 551 YILPAIVHINNQPPIRRG---DGPIALVLAPTRELAQQI 658 Y P + + P + G G A+V++PTRELAQQI Sbjct: 183 YTTPTPIQMQATPLMAHGPKKSGFRAVVVSPTRELAQQI 221 >SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) Length = 978 Score = 48.4 bits (110), Expect = 6e-06 Identities = 31/81 (38%), Positives = 42/81 (51%), Gaps = 5/81 (6%) Frame = +2 Query: 524 QTGSGKTLAYILPAIVHINNQPPIRRG-----DGPIALVLAPTRELAQQIQQVAADFGHT 688 QTGSGKTLAY+ P +VH + R G P A ++ P RELA QI + A H Sbjct: 423 QTGSGKTLAYLAP-LVHRLREDEERHGILARLKRPRACIVVPARELATQILKTAKSLCHH 481 Query: 689 SYVRNTCVFGGAPKREQARDL 751 + R+ + GG ++ DL Sbjct: 482 ARFRSVGLIGGRKQKWMRDDL 502 >SB_52320| Best HMM Match : DEAD (HMM E-Value=0) Length = 340 Score = 48.0 bits (109), Expect = 8e-06 Identities = 31/75 (41%), Positives = 42/75 (56%), Gaps = 1/75 (1%) Frame = +2 Query: 524 QTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRN 703 +TGSGKTLA+++P I + Q DG ALV++PTRELA Q +V G+ + Sbjct: 95 KTGSGKTLAFLIPIIETLWRQKWTSM-DGLGALVISPTRELAYQTFEVLVKIGNKHDLSA 153 Query: 704 TCVFGGAP-KREQAR 745 + GG K EQ R Sbjct: 154 GLIIGGKDLKNEQKR 168 Score = 31.1 bits (67), Expect = 1.0 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +1 Query: 388 IQXFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGK 507 ++ F + G+ G+ PT IQ QG P+A+SG+ Sbjct: 49 VEKFSDFPISKRTLDGLMKAGFVTPTDIQKQGIPVALSGR 88 >SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 370 Score = 44.8 bits (101), Expect = 8e-05 Identities = 30/78 (38%), Positives = 41/78 (52%) Frame = +2 Query: 518 RTQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYV 697 + Q+G+GKT + + + I+ Q +R P ALVL+PTRELA QIQ+V G V Sbjct: 40 QAQSGTGKTATFSISVLQAIDTQ--LRE---PQALVLSPTRELANQIQKVVLALGDYMSV 94 Query: 698 RNTCVFGGAPKREQARDL 751 + GG E R L Sbjct: 95 QCHACIGGTNIGEDIRKL 112 >SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 44.0 bits (99), Expect = 1e-04 Identities = 23/66 (34%), Positives = 38/66 (57%) Frame = +2 Query: 524 QTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRN 703 +TGSGKT A+++P + G AL+L+PTRELA Q Q+ + G + +++ Sbjct: 326 RTGSGKTAAFLIPMFEKLQTHTA---KVGIRALILSPTRELALQTQKFIKELGRFTGLKS 382 Query: 704 TCVFGG 721 + + GG Sbjct: 383 SVILGG 388 >SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1448 Score = 43.6 bits (98), Expect = 2e-04 Identities = 24/76 (31%), Positives = 42/76 (55%) Frame = +2 Query: 524 QTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRN 703 +TGSGKTLA+++P +V + + + +G ++++PTREL+ Q VA D Sbjct: 617 KTGSGKTLAFLVP-VVELLYKLQFKTRNGTGVIIISPTRELSLQTYGVARDLLKHHNFTY 675 Query: 704 TCVFGGAPKREQARDL 751 + GG ++ +A L Sbjct: 676 GIIMGGVNRKAEAERL 691 >SB_9558| Best HMM Match : DEAD (HMM E-Value=0) Length = 436 Score = 43.6 bits (98), Expect = 2e-04 Identities = 28/76 (36%), Positives = 38/76 (50%) Frame = +2 Query: 524 QTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRN 703 +TGSGKT A+ LP + + + P G A+VL PTRELA QI G ++ Sbjct: 52 KTGSGKTAAFALPILQKLCDDPY-----GIFAVVLTPTRELAFQIADQFKVLGRPIGLKE 106 Query: 704 TCVFGGAPKREQARDL 751 + GG +QA L Sbjct: 107 AVIVGGLDMMKQALSL 122 >SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) Length = 238 Score = 41.5 bits (93), Expect = 7e-04 Identities = 27/73 (36%), Positives = 36/73 (49%) Frame = +2 Query: 524 QTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRN 703 +TGSGKT A+ LP + + + P AL+L PTRELA QI + G V+ Sbjct: 9 ETGSGKTGAFALPILQALLDNP-----QRLFALILTPTRELAFQISEQCEALGSGIGVKC 63 Query: 704 TCVFGGAPKREQA 742 + GG QA Sbjct: 64 AVIVGGIDMMSQA 76 >SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) Length = 185 Score = 41.5 bits (93), Expect = 7e-04 Identities = 21/52 (40%), Positives = 28/52 (53%) Frame = +1 Query: 352 EVTVSGVEVHNPIQXFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGK 507 EV VSG I FEEAN + V+ YK+PTP+Q PI ++G+ Sbjct: 121 EVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGR 172 >SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 697 Score = 41.1 bits (92), Expect = 0.001 Identities = 31/88 (35%), Positives = 46/88 (52%), Gaps = 16/88 (18%) Frame = +2 Query: 524 QTGSGKTLAYILPAIVHIN-------NQPPI-------RRGDGPIALVLAPTRELAQQIQ 661 +TGSGKTLA+ +P I HI Q P +G +AL++APTRELA Q++ Sbjct: 176 ETGSGKTLAFGIPIIQHIEAYKKRKAEQSPSDKESDLESQGYPLLALIMAPTRELALQVK 235 Query: 662 QVAADFGHTSYVRNTCVFGG--APKREQ 739 + V+ + GG APK+++ Sbjct: 236 DHLVKAAKYTSVKVAAIVGGMAAPKQQR 263 >SB_17563| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 38.3 bits (85), Expect = 0.007 Identities = 21/55 (38%), Positives = 30/55 (54%) Frame = +2 Query: 518 RTQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG 682 R + G+GKT AY++P + + + ALVL PTRELA Q Q+ + G Sbjct: 90 RAKNGTGKTAAYLVPLLERTDTTKNCIQ-----ALVLVPTRELALQTSQICIELG 139 Score = 29.5 bits (63), Expect = 3.1 Identities = 13/41 (31%), Positives = 24/41 (58%) Frame = +1 Query: 397 FEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKI*LA 519 FE+ + G+ G+ +P+PIQ + P+A++G+ LA Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILA 89 >SB_2247| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 38.3 bits (85), Expect = 0.007 Identities = 21/55 (38%), Positives = 30/55 (54%) Frame = +2 Query: 518 RTQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG 682 R + G+GKT AY++P + + + ALVL PTRELA Q Q+ + G Sbjct: 90 RAKNGTGKTAAYLVPLLERTDTTKNCIQ-----ALVLVPTRELALQTSQICIELG 139 Score = 29.5 bits (63), Expect = 3.1 Identities = 13/41 (31%), Positives = 24/41 (58%) Frame = +1 Query: 397 FEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKI*LA 519 FE+ + G+ G+ +P+PIQ + P+A++G+ LA Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILA 89 >SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) Length = 120 Score = 37.5 bits (83), Expect = 0.012 Identities = 22/47 (46%), Positives = 25/47 (53%) Frame = +2 Query: 611 PIALVLAPTRELAQQIQQVAADFGHTSYVRNTCVFGGAPKREQARDL 751 P ALVL+PTRELA QIQ+V G V+ GG E R L Sbjct: 4 PQALVLSPTRELANQIQKVVLALGDYMSVQCHACIGGTNIGEDIRKL 50 >SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) Length = 490 Score = 37.1 bits (82), Expect = 0.015 Identities = 25/80 (31%), Positives = 44/80 (55%), Gaps = 3/80 (3%) Frame = +2 Query: 518 RTQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG-HTSY 694 ++Q+G+GKT A++L + ++ P P + L+PT ELA+Q +VA G H + Sbjct: 148 QSQSGTGKTAAFVLTMLSRVDATKPY-----PQVICLSPTYELARQTGKVAEAMGKHCPH 202 Query: 695 VR-NTCVFGGA-PKREQARD 748 ++ N V G P+ ++ D Sbjct: 203 IKINYAVRGNQFPRGQKCTD 222 Score = 29.5 bits (63), Expect = 3.1 Identities = 16/54 (29%), Positives = 29/54 (53%), Gaps = 3/54 (5%) Frame = +1 Query: 349 HEVTVSGVEVHNPI---QXFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMS 501 HEV V + +P+ + FEE +++GV MG+ +P+ IQ P+ ++ Sbjct: 86 HEVEVLRSDPSSPLYSAKSFEELPLSANLRRGVYDMGFNKPSKIQETALPMLLA 139 >SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) Length = 559 Score = 35.5 bits (78), Expect = 0.047 Identities = 24/61 (39%), Positives = 38/61 (62%), Gaps = 1/61 (1%) Frame = +2 Query: 518 RTQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELA-QQIQQVAADFGHTSY 694 +++TG+GK+L ++LP++ Q P RG G I ++ PTRELA Q + +V+ G S Sbjct: 203 KSETGTGKSLVFLLPSV-----QDP-GRGYGTI--IVVPTRELASQMLYEVSRLLGDKSI 254 Query: 695 V 697 V Sbjct: 255 V 255 >SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) Length = 456 Score = 33.5 bits (73), Expect = 0.19 Identities = 21/74 (28%), Positives = 34/74 (45%), Gaps = 4/74 (5%) Frame = +2 Query: 530 GSGKTLAYILPAIVHINNQPPIRR---GDGPIALVLAPTRELAQQIQQVAAD-FGHTSYV 697 GSGK LAY+LP I I + +GP+ L+L + ++ V D + Sbjct: 234 GSGKRLAYLLPIIHQITESSVYQELPLANGPLVLILCTNWQNTARVYGVCEDLIRNRRRT 293 Query: 698 RNTCVFGGAPKREQ 739 R +FGG + ++ Sbjct: 294 RVQMIFGGGAEEDR 307 >SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) Length = 96 Score = 33.1 bits (72), Expect = 0.25 Identities = 18/43 (41%), Positives = 26/43 (60%) Frame = +2 Query: 527 TGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQ 655 TG+GKT A++LP + + +P + LV+ PTRELA Q Sbjct: 56 TGTGKTAAFMLPILERLLYRP--TQSPAIRVLVITPTRELAIQ 96 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +1 Query: 430 QGVKTMGYKEPTPIQAQGWPIAMSGK 507 + V +G+ PTPIQA P+A+ GK Sbjct: 23 RAVNELGFLHPTPIQASTIPVALMGK 48 >SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 480 Score = 31.1 bits (67), Expect = 1.0 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = +1 Query: 373 EVHNPIQXFEEANFPDYVQQGVKTMGYKEPTPIQAQGW 486 ++H P++ + FP Y + Y P P QA W Sbjct: 6 DIHGPVRKLHKHGFPGYEEDYAAVFKYPTPWPEQAMEW 43 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = +1 Query: 388 IQXFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGK 507 I FE+ + + + V GYK+PTP+Q PI + GK Sbjct: 874 ILQFEDVDLGEILLHNVGLAGYKKPTPVQKYAIPI-VKGK 912 Score = 27.9 bits (59), Expect = 9.4 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 524 QTGSGKTLAYILPAIVHINNQPP 592 QTGSGKT A+++P + I + P Sbjct: 920 QTGSGKTAAFLIPILSRIYMEGP 942 >SB_26138| Best HMM Match : RhoGEF (HMM E-Value=0.0011) Length = 1199 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +2 Query: 227 QNMRRPDWDLFHSNLSTKTFMIHILQFSKD 316 +N RR WD FHSN+S + H+ F D Sbjct: 768 RNKRR--WDSFHSNVSADSGSAHMFDFDTD 795 >SB_32980| Best HMM Match : DEAD (HMM E-Value=0) Length = 985 Score = 28.3 bits (60), Expect = 7.1 Identities = 20/79 (25%), Positives = 37/79 (46%), Gaps = 1/79 (1%) Frame = +2 Query: 518 RTQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG-HTSY 694 + ++G+GKT + + A+ ++ I + ++L PTRE+A Q++ V G H Sbjct: 56 QAKSGTGKTCVFSVIALENV-----ITESNCIQIIILTPTREIAVQVKDVICAIGCHYDG 110 Query: 695 VRNTCVFGGAPKREQARDL 751 + GG E + L Sbjct: 111 LACKVFIGGISLEEDKKAL 129 >SB_19782| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 728 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = -2 Query: 233 CSDLQRILFSHQILQILQIYCHRC-QIETN 147 CS +L +IL+ +YC +C Q ETN Sbjct: 14 CSLCSEVLTEPKILRCFHVYCQKCLQAETN 43 >SB_8125| Best HMM Match : MFS_1 (HMM E-Value=3.2e-07) Length = 401 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = -2 Query: 164 CQIETNYRRICCLLQIWN-HRFHGYYSS 84 C + +YRR CC L +W H + Y+SS Sbjct: 218 CCVRVDYRRKCC-LHVWRVHTTNTYWSS 244 >SB_19342| Best HMM Match : Keratin_B2 (HMM E-Value=0.41) Length = 1093 Score = 27.9 bits (59), Expect = 9.4 Identities = 19/75 (25%), Positives = 36/75 (48%) Frame = +2 Query: 521 TQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVR 700 TQT +L +P +HIN+ P R PI + + PT+ + I ++ D ++ + Sbjct: 430 TQTTKPASLRVNVPLSLHINDSSPTRL-SFPITMDVHPTKTTSVTI-PISEDMQTSTIAK 487 Query: 701 NTCVFGGAPKREQAR 745 T F + +E ++ Sbjct: 488 QTSSFPRSNDKEASK 502 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,450,560 Number of Sequences: 59808 Number of extensions: 464476 Number of successful extensions: 1212 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 1130 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1197 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2046258890 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -