BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021010 (652 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 24 1.2 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 23 2.9 AJ850293-1|CAH64513.1| 539|Tribolium castaneum putative esteras... 21 6.7 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 23.8 bits (49), Expect = 1.2 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +2 Query: 134 NLSLSQVTSGTSAVLSWTPVAPESLRGHFKGYKIQTWTD 250 +LSL+ + + LSW ++ S G +K +W D Sbjct: 362 SLSLASAQTLSELDLSWNSISSLSHGGQLARFKCLSWLD 400 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 22.6 bits (46), Expect = 2.9 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 Query: 340 VRILAYNGSFNGPASDTLSFVTPEGQP 420 V + A+N GP SD + T EG P Sbjct: 1074 VVVQAFNKVGAGPLSDDIKAYTAEGVP 1100 Score = 21.4 bits (43), Expect = 6.7 Identities = 6/15 (40%), Positives = 11/15 (73%) Frame = +3 Query: 465 MLLKWEKPMEENGVL 509 +L W+ P+E NG++ Sbjct: 1217 ILASWKPPVEPNGIV 1231 >AJ850293-1|CAH64513.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 21.4 bits (43), Expect = 6.7 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = -3 Query: 461 EEPIG*ASKERTVEGCPSGVTKLRVSLAGPLK 366 E+P+ K T+ GC + T +R + P + Sbjct: 233 EQPLAQTKKLATIVGCGTDETMIRCLKSRPAR 264 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.317 0.137 0.398 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 117,904 Number of Sequences: 336 Number of extensions: 2073 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16760905 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -