BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021006 (801 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB8E5.02c |rpn502|rpn5, rpn5-b|19S proteasome regulatory subu... 27 4.1 SPAC1420.03 |rpn501|rpn5-a, rpn5|19S proteasome regulatory subun... 27 4.1 SPAC57A7.10c |sec21||coatomer gamma subunit Sec21 |Schizosacchar... 26 7.2 SPAC144.15c |cog1||Golgi transport complex subunit Cog1 |Schizos... 26 7.2 >SPAPB8E5.02c |rpn502|rpn5, rpn5-b|19S proteasome regulatory subunit Rpn502|Schizosaccharomyces pombe|chr 1|||Manual Length = 443 Score = 26.6 bits (56), Expect = 4.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 273 RFHCRILSATLDMSPKRTTQ 214 R HC L LDMSP T Q Sbjct: 354 RIHCSRLGVLLDMSPSETEQ 373 >SPAC1420.03 |rpn501|rpn5-a, rpn5|19S proteasome regulatory subunit Rpn501|Schizosaccharomyces pombe|chr 1|||Manual Length = 443 Score = 26.6 bits (56), Expect = 4.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 273 RFHCRILSATLDMSPKRTTQ 214 R HC L LDMSP T Q Sbjct: 354 RIHCSRLGVLLDMSPSETEQ 373 >SPAC57A7.10c |sec21||coatomer gamma subunit Sec21 |Schizosaccharomyces pombe|chr 1|||Manual Length = 905 Score = 25.8 bits (54), Expect = 7.2 Identities = 16/62 (25%), Positives = 25/62 (40%) Frame = -2 Query: 587 STICIS*HFNFPIIMVVMNHWAVSPDPAVPEL*NG*KVTCLRSFVRTSQLEPTYGGLSQL 408 S +S + +P+ +++ W AV G KV F T P G+SQ Sbjct: 154 SAALVSAYHLYPVAKDIVSRWNNEVQDAVTSHNVGRKVASSPFFTSTLGYTPNASGISQY 213 Query: 407 HS 402 H+ Sbjct: 214 HA 215 >SPAC144.15c |cog1||Golgi transport complex subunit Cog1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 701 Score = 25.8 bits (54), Expect = 7.2 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -1 Query: 336 FGPAWAIRPSLIFTIDLLAIIRF 268 FGP++A+ SLI ID L ++ F Sbjct: 565 FGPSFALYNSLIMLIDKLEVLGF 587 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,231,775 Number of Sequences: 5004 Number of extensions: 65096 Number of successful extensions: 184 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 179 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 184 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 388424860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -