BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021005 (734 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 23 2.3 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 5.2 AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phospha... 21 9.1 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 23.4 bits (48), Expect = 2.3 Identities = 11/38 (28%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -1 Query: 611 SVLTISISFGRPFL-CAKIKSSNPICPPRSFFISTCEY 501 SV ++ I P + C S +C P + + CEY Sbjct: 124 SVTSVGIDLEMPSVECIVFNSGTILCVPFTTYTPVCEY 161 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.2 bits (45), Expect = 5.2 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = -1 Query: 647 APLSVIVNPRASSVLTISISFGRPFL 570 +P+SV V+P A+SV+ +++ P L Sbjct: 458 SPMSVQVDPMAASVVAAALTGTYPTL 483 >AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phosphate dehydrogenase protein. Length = 363 Score = 21.4 bits (43), Expect = 9.1 Identities = 8/29 (27%), Positives = 17/29 (58%) Frame = +3 Query: 324 LLESIIATVRRSHNWSSTVSKLTEVHWAS 410 + E + + S NW ST++K+ ++ A+ Sbjct: 1 MAEKLRICIVGSGNWGSTIAKIIGINAAN 29 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 195,375 Number of Sequences: 438 Number of extensions: 4237 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22901220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -