SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NRPG1797
         (714 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY336529-1|AAQ02340.1|  712|Apis mellifera transferrin protein.        22   6.6  
AY336528-1|AAQ02339.1|  712|Apis mellifera transferrin protein.        22   6.6  
AY217097-1|AAO39761.1|  712|Apis mellifera transferrin protein.        22   6.6  
DQ325133-1|ABD14147.1|  181|Apis mellifera complementary sex det...    21   8.8  
DQ325075-1|ABD14089.1|  181|Apis mellifera complementary sex det...    21   8.8  
DQ325074-1|ABD14088.1|  181|Apis mellifera complementary sex det...    21   8.8  
DQ325073-1|ABD14087.1|  181|Apis mellifera complementary sex det...    21   8.8  
DQ325072-1|ABD14086.1|  181|Apis mellifera complementary sex det...    21   8.8  
DQ325071-1|ABD14085.1|  181|Apis mellifera complementary sex det...    21   8.8  
DQ325070-1|ABD14084.1|  181|Apis mellifera complementary sex det...    21   8.8  
DQ325069-1|ABD14083.1|  181|Apis mellifera complementary sex det...    21   8.8  
DQ325068-1|ABD14082.1|  181|Apis mellifera complementary sex det...    21   8.8  
AY569696-1|AAS86649.1|  414|Apis mellifera complementary sex det...    21   8.8  
AY569695-1|AAS86648.1|  414|Apis mellifera complementary sex det...    21   8.8  

>AY336529-1|AAQ02340.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 21.8 bits (44), Expect = 6.6
 Identities = 13/38 (34%), Positives = 17/38 (44%)
 Frame = +3

Query: 528 RSRTIAKLKKDGLIKADLNLEKVLQDCFHDWPESNKRL 641
           ++ T A   +D   K D  LEK   DC     E+N  L
Sbjct: 400 KALTRAAYSRDVRPKYDCTLEKSQDDCLKAIKENNADL 437


>AY336528-1|AAQ02339.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 21.8 bits (44), Expect = 6.6
 Identities = 13/38 (34%), Positives = 17/38 (44%)
 Frame = +3

Query: 528 RSRTIAKLKKDGLIKADLNLEKVLQDCFHDWPESNKRL 641
           ++ T A   +D   K D  LEK   DC     E+N  L
Sbjct: 400 KALTRAAYSRDVRPKYDCTLEKSQDDCLKAIKENNADL 437


>AY217097-1|AAO39761.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 21.8 bits (44), Expect = 6.6
 Identities = 13/38 (34%), Positives = 17/38 (44%)
 Frame = +3

Query: 528 RSRTIAKLKKDGLIKADLNLEKVLQDCFHDWPESNKRL 641
           ++ T A   +D   K D  LEK   DC     E+N  L
Sbjct: 400 KALTRAAYSRDVRPKYDCTLEKSQDDCLKAIKENNADL 437


>DQ325133-1|ABD14147.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.4 bits (43), Expect = 8.8
 Identities = 6/12 (50%), Positives = 10/12 (83%)
 Frame = +2

Query: 485 HNYNQTHYQISH 520
           HNYN+ +Y I++
Sbjct: 104 HNYNKLYYNINY 115


>DQ325075-1|ABD14089.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.4 bits (43), Expect = 8.8
 Identities = 6/12 (50%), Positives = 10/12 (83%)
 Frame = +2

Query: 485 HNYNQTHYQISH 520
           HNYN+ +Y I++
Sbjct: 104 HNYNKLYYNINY 115


>DQ325074-1|ABD14088.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.4 bits (43), Expect = 8.8
 Identities = 6/12 (50%), Positives = 10/12 (83%)
 Frame = +2

Query: 485 HNYNQTHYQISH 520
           HNYN+ +Y I++
Sbjct: 104 HNYNKLYYNINY 115


>DQ325073-1|ABD14087.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.4 bits (43), Expect = 8.8
 Identities = 6/12 (50%), Positives = 10/12 (83%)
 Frame = +2

Query: 485 HNYNQTHYQISH 520
           HNYN+ +Y I++
Sbjct: 104 HNYNKLYYNINY 115


>DQ325072-1|ABD14086.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.4 bits (43), Expect = 8.8
 Identities = 6/12 (50%), Positives = 10/12 (83%)
 Frame = +2

Query: 485 HNYNQTHYQISH 520
           HNYN+ +Y I++
Sbjct: 104 HNYNKLYYNINY 115


>DQ325071-1|ABD14085.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.4 bits (43), Expect = 8.8
 Identities = 6/12 (50%), Positives = 10/12 (83%)
 Frame = +2

Query: 485 HNYNQTHYQISH 520
           HNYN+ +Y I++
Sbjct: 104 HNYNKLYYNINY 115


>DQ325070-1|ABD14084.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.4 bits (43), Expect = 8.8
 Identities = 6/12 (50%), Positives = 10/12 (83%)
 Frame = +2

Query: 485 HNYNQTHYQISH 520
           HNYN+ +Y I++
Sbjct: 104 HNYNKLYYNINY 115


>DQ325069-1|ABD14083.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.4 bits (43), Expect = 8.8
 Identities = 6/12 (50%), Positives = 10/12 (83%)
 Frame = +2

Query: 485 HNYNQTHYQISH 520
           HNYN+ +Y I++
Sbjct: 104 HNYNKLYYNINY 115


>DQ325068-1|ABD14082.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.4 bits (43), Expect = 8.8
 Identities = 6/12 (50%), Positives = 10/12 (83%)
 Frame = +2

Query: 485 HNYNQTHYQISH 520
           HNYN+ +Y I++
Sbjct: 104 HNYNKLYYNINY 115


>AY569696-1|AAS86649.1|  414|Apis mellifera complementary sex
           determiner protein.
          Length = 414

 Score = 21.4 bits (43), Expect = 8.8
 Identities = 6/12 (50%), Positives = 10/12 (83%)
 Frame = +2

Query: 485 HNYNQTHYQISH 520
           HNYN+ +Y I++
Sbjct: 337 HNYNKLYYNINY 348


>AY569695-1|AAS86648.1|  414|Apis mellifera complementary sex
           determiner protein.
          Length = 414

 Score = 21.4 bits (43), Expect = 8.8
 Identities = 6/12 (50%), Positives = 10/12 (83%)
 Frame = +2

Query: 485 HNYNQTHYQISH 520
           HNYN+ +Y I++
Sbjct: 337 HNYNKLYYNINY 348


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 190,794
Number of Sequences: 438
Number of extensions: 4175
Number of successful extensions: 26
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 25
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 26
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 22048515
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -