BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= NRPG1797
(714 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 22 6.6
AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 22 6.6
AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 22 6.6
DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 21 8.8
DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 21 8.8
DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 21 8.8
DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 21 8.8
DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 21 8.8
DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 21 8.8
DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 21 8.8
DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 21 8.8
DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 21 8.8
AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 21 8.8
AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 21 8.8
>AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein.
Length = 712
Score = 21.8 bits (44), Expect = 6.6
Identities = 13/38 (34%), Positives = 17/38 (44%)
Frame = +3
Query: 528 RSRTIAKLKKDGLIKADLNLEKVLQDCFHDWPESNKRL 641
++ T A +D K D LEK DC E+N L
Sbjct: 400 KALTRAAYSRDVRPKYDCTLEKSQDDCLKAIKENNADL 437
>AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein.
Length = 712
Score = 21.8 bits (44), Expect = 6.6
Identities = 13/38 (34%), Positives = 17/38 (44%)
Frame = +3
Query: 528 RSRTIAKLKKDGLIKADLNLEKVLQDCFHDWPESNKRL 641
++ T A +D K D LEK DC E+N L
Sbjct: 400 KALTRAAYSRDVRPKYDCTLEKSQDDCLKAIKENNADL 437
>AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein.
Length = 712
Score = 21.8 bits (44), Expect = 6.6
Identities = 13/38 (34%), Positives = 17/38 (44%)
Frame = +3
Query: 528 RSRTIAKLKKDGLIKADLNLEKVLQDCFHDWPESNKRL 641
++ T A +D K D LEK DC E+N L
Sbjct: 400 KALTRAAYSRDVRPKYDCTLEKSQDDCLKAIKENNADL 437
>DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex
determiner protein.
Length = 181
Score = 21.4 bits (43), Expect = 8.8
Identities = 6/12 (50%), Positives = 10/12 (83%)
Frame = +2
Query: 485 HNYNQTHYQISH 520
HNYN+ +Y I++
Sbjct: 104 HNYNKLYYNINY 115
>DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex
determiner protein.
Length = 181
Score = 21.4 bits (43), Expect = 8.8
Identities = 6/12 (50%), Positives = 10/12 (83%)
Frame = +2
Query: 485 HNYNQTHYQISH 520
HNYN+ +Y I++
Sbjct: 104 HNYNKLYYNINY 115
>DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex
determiner protein.
Length = 181
Score = 21.4 bits (43), Expect = 8.8
Identities = 6/12 (50%), Positives = 10/12 (83%)
Frame = +2
Query: 485 HNYNQTHYQISH 520
HNYN+ +Y I++
Sbjct: 104 HNYNKLYYNINY 115
>DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex
determiner protein.
Length = 181
Score = 21.4 bits (43), Expect = 8.8
Identities = 6/12 (50%), Positives = 10/12 (83%)
Frame = +2
Query: 485 HNYNQTHYQISH 520
HNYN+ +Y I++
Sbjct: 104 HNYNKLYYNINY 115
>DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex
determiner protein.
Length = 181
Score = 21.4 bits (43), Expect = 8.8
Identities = 6/12 (50%), Positives = 10/12 (83%)
Frame = +2
Query: 485 HNYNQTHYQISH 520
HNYN+ +Y I++
Sbjct: 104 HNYNKLYYNINY 115
>DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex
determiner protein.
Length = 181
Score = 21.4 bits (43), Expect = 8.8
Identities = 6/12 (50%), Positives = 10/12 (83%)
Frame = +2
Query: 485 HNYNQTHYQISH 520
HNYN+ +Y I++
Sbjct: 104 HNYNKLYYNINY 115
>DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex
determiner protein.
Length = 181
Score = 21.4 bits (43), Expect = 8.8
Identities = 6/12 (50%), Positives = 10/12 (83%)
Frame = +2
Query: 485 HNYNQTHYQISH 520
HNYN+ +Y I++
Sbjct: 104 HNYNKLYYNINY 115
>DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex
determiner protein.
Length = 181
Score = 21.4 bits (43), Expect = 8.8
Identities = 6/12 (50%), Positives = 10/12 (83%)
Frame = +2
Query: 485 HNYNQTHYQISH 520
HNYN+ +Y I++
Sbjct: 104 HNYNKLYYNINY 115
>DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex
determiner protein.
Length = 181
Score = 21.4 bits (43), Expect = 8.8
Identities = 6/12 (50%), Positives = 10/12 (83%)
Frame = +2
Query: 485 HNYNQTHYQISH 520
HNYN+ +Y I++
Sbjct: 104 HNYNKLYYNINY 115
>AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex
determiner protein.
Length = 414
Score = 21.4 bits (43), Expect = 8.8
Identities = 6/12 (50%), Positives = 10/12 (83%)
Frame = +2
Query: 485 HNYNQTHYQISH 520
HNYN+ +Y I++
Sbjct: 337 HNYNKLYYNINY 348
>AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex
determiner protein.
Length = 414
Score = 21.4 bits (43), Expect = 8.8
Identities = 6/12 (50%), Positives = 10/12 (83%)
Frame = +2
Query: 485 HNYNQTHYQISH 520
HNYN+ +Y I++
Sbjct: 337 HNYNKLYYNINY 348
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 190,794
Number of Sequences: 438
Number of extensions: 4175
Number of successful extensions: 26
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 25
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 26
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 22048515
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -