SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NRPG1534
         (661 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ244074-1|ABB36784.1|  517|Apis mellifera cytochrome P450 monoo...    22   4.5  
AB193550-1|BAD66824.1|  699|Apis mellifera soluble guanylyl cycl...    22   4.5  
AY921573-1|AAX62923.1|  694|Apis mellifera D2-like dopamine rece...    22   6.0  
AY569709-1|AAS86662.1|  408|Apis mellifera complementary sex det...    21   7.9  

>DQ244074-1|ABB36784.1|  517|Apis mellifera cytochrome P450
           monooxygenase protein.
          Length = 517

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = +3

Query: 363 SWWFWT 380
           +WWFWT
Sbjct: 28  AWWFWT 33


>AB193550-1|BAD66824.1|  699|Apis mellifera soluble guanylyl cyclase
           alpha 1 subunit protein.
          Length = 699

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -2

Query: 309 YFAFTNNCGISRT 271
           YF FT  CGI+ T
Sbjct: 332 YFTFTRPCGITLT 344


>AY921573-1|AAX62923.1|  694|Apis mellifera D2-like dopamine
           receptor protein.
          Length = 694

 Score = 21.8 bits (44), Expect = 6.0
 Identities = 11/29 (37%), Positives = 12/29 (41%)
 Frame = +3

Query: 567 WRIRGRIDTAGYTGRKNTCRRCRYSCLFY 653
           W I   I +    G  NT  R    CLFY
Sbjct: 311 WAISAAIGSPIVLGLNNTPDRTPDQCLFY 339


>AY569709-1|AAS86662.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 21.4 bits (43), Expect = 7.9
 Identities = 9/35 (25%), Positives = 21/35 (60%)
 Frame = +2

Query: 545 NLKDNF*VEN*R*N*HRRVHWQKEYVQEVQVFLPF 649
           +L +N+   N   N ++ +H+   Y++++ V +PF
Sbjct: 317 SLSNNYNYNNYNNN-YKPLHYNINYIEQIPVPVPF 350


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 172,941
Number of Sequences: 438
Number of extensions: 3302
Number of successful extensions: 6
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 19855845
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -