BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0686 (668 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC006969-1|AAH06969.1| 352|Homo sapiens dynein, cytoplasmic 2, ... 30 8.6 AC011242-2|AAY14702.1| 352|Homo sapiens unknown protein. 30 8.6 >BC006969-1|AAH06969.1| 352|Homo sapiens dynein, cytoplasmic 2, light intermediate chain 1 protein. Length = 352 Score = 29.9 bits (64), Expect = 8.6 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = -2 Query: 142 PQDLELLLPKIPISNIILGYSYVTSQILSSSNRYVVC 32 PQD EL+ P P+ +I+G Y Q S R V+C Sbjct: 169 PQDHELIDP-FPVPLVIIGSKYDVFQDFESEKRKVIC 204 >AC011242-2|AAY14702.1| 352|Homo sapiens unknown protein. Length = 352 Score = 29.9 bits (64), Expect = 8.6 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = -2 Query: 142 PQDLELLLPKIPISNIILGYSYVTSQILSSSNRYVVC 32 PQD EL+ P P+ +I+G Y Q S R V+C Sbjct: 169 PQDHELIDP-FPVPLVIIGSKYDVFQDFESEKRKVIC 204 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 89,157,864 Number of Sequences: 237096 Number of extensions: 1685434 Number of successful extensions: 2283 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2247 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2283 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7591280850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -