BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0685 (701 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46989| Best HMM Match : Pox_A32 (HMM E-Value=0.023) 29 4.8 SB_9232| Best HMM Match : Coq4 (HMM E-Value=1.8) 28 6.4 SB_14096| Best HMM Match : DUF595 (HMM E-Value=2.1) 28 8.4 >SB_46989| Best HMM Match : Pox_A32 (HMM E-Value=0.023) Length = 719 Score = 28.7 bits (61), Expect = 4.8 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = -1 Query: 449 GKWLPSPMDFSNA-RSRAKPLPTAQHSPQASLEEGHVIAFGKHRGGE 312 G++L P++ A + RA P +P LEE AFGKH E Sbjct: 100 GRYLMLPLEIIPAVKQRALPERNEAWAPYRLLEEERQFAFGKHSMAE 146 >SB_9232| Best HMM Match : Coq4 (HMM E-Value=1.8) Length = 1392 Score = 28.3 bits (60), Expect = 6.4 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 2/55 (3%) Frame = -2 Query: 523 DLYKIQLSFFFLLPL*ADERTAHLMV--SGYRRPWTSAMPGAEPSRCLLPNTLHK 365 DL+ ++ F + L +R A MV G RP++ A+ P L+ +LHK Sbjct: 981 DLFLNKIPKRFTMGLVTVDRVAETMVRVKGETRPYSEALTSTPPGYALMYRSLHK 1035 >SB_14096| Best HMM Match : DUF595 (HMM E-Value=2.1) Length = 233 Score = 27.9 bits (59), Expect = 8.4 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +1 Query: 322 RCFPNAMTCPSSSEACGECWAV 387 RCF N MT S CG W++ Sbjct: 172 RCFVNLMTWEEKSNDCGHLWSM 193 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,544,649 Number of Sequences: 59808 Number of extensions: 408758 Number of successful extensions: 900 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 844 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 900 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1841633001 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -